KEGG   Babesia bovis: BBOV_III001650Help
Entry
BBOV_III001650    CDS       T01085                                 

Gene name
17.m07166
Definition
ubiquitin carboxyl-terminal hydrolase family protein
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
bbo  Babesia bovis
Brite
Enzymes [BR:bbo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     BBOV_III001650 (17.m07166)
Peptidases [BR:bbo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   BBOV_III001650 (17.m07166)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1073 aa AA seqDB search
MTDRWKDNVSPWAIGERRSLFATKRAGQLHRNGLSNGGMKMHENSERQPRLWSKLSSSVI
NGSDSAASRPDQGSFTTDSSRRDPSSIPGNSRIISTVDTTKRADDNAKSDEYRHFQEIPA
VDEIVHLLPDTYSEKLMIQLIDDRLSSPKPHKTNSIDAESRETTADGEALTDRLSSIRDL
EPPLEEIPVEDTTHDIQEPAGKAADFIARVGSNPFAIFRLKHARSVVNVGETELSHVKAV
ILSKRHSPEELHSLFKSSISVTNVQMMRLILQFLQDIMLTDITYRELCVRMMETALVYHP
DELVQCFSCVHIATLFEPEVNDDVGGRFIRLFLSYKATFGACGKQDAGVPTWVNSKGYFC
YDTENADTSDLPPVPPRMISSYNNFQVETEGLDGTKVRNAKYPPFAGSDNNPFIGYGRIE
SLTLLKICADRAGVSSVFDIPASRLRDWVCTIWYELPATRPCLPLMMTCINWINACDDPM
FLKDAAFALLKKELSLRGDFEGGRLLMLDLLSFMAKRCGVASVELSRIVDMLAEGEDNIL
YAVLDSIISNNFTEDSMLNLWCLLCILPWPVSSPDSAICRLLSSTFLIYYQLAYNALRDE
GPSIHFKTNPMGLIENALRICVCRCSSPILSKDALLQTILLVELSPLPAVKMTNAPLILS
SLCPFLWKCHFVWSNCGRDADKDSIIALRHLYNVLRTCVFCEPLNSASDELGTRKVPIFP
RVQFESDETMSADVESFIGASKTLDPSLSDTPNEVIEEQVMPEVKIPVSKTILDRPRGLR
NLGNTCYYNSMLQALFHTRGFVHGLFELSEENDYVSVYKRIFHKLMKRGKKVFDPRSGYK
MLPSQWTSRCEQQDVTETLAHVMEELDPTLSLRRRIFAGLVLRRVKCLGCGNLSDNREVV
MDFTFPVNGLRSIQAMFDDFCKIETLRGGNRYFCSKCDSYRRAEMWNVIASPPAHLMIVL
SRHMWPMGSKAQGVHSGAGKLLEHITINDKLQIYDFDYTLYGSIFHVGVDASSGHYYFVG
RDSEGYSKWYICDDSQVREVNETTVNDISQNTYNSDVPYVLFYRCAQAPPTPL
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atgacagataggtggaaagataacgttagtccttgggctataggggaacgaaggtcactt
tttgcaactaaaagagccggtcaactccatcgtaatgggttatcaaatggaggtatgaaa
atgcatgaaaactctgaacgccaaccacgtttatggagcaaattatcctcttctgtaata
aatggaagcgactctgctgcatccagaccggatcaggggtcgtttacaactgactcaagc
aggagggatccttcgtcaattcccggaaactcaaggattatttcaactgttgacacaacc
aagagagctgatgacaatgcaaaatcggatgaatatcgacattttcaggaaattcctgct
gttgatgaaatcgtacatctgcttcccgatacgtattcggaaaagcttatgatacagctg
atagatgatcgattatcatcccccaaacctcacaagactaactctatagatgctgaatcg
cgtgagactaccgcggatggagaagcactgactgatagattatcatcaataagagactta
gaacctcctttggaggaaattcctgtggaggacactacacatgatatacaggaaccagct
ggtaaagccgcagattttatcgcaagagtaggatccaatccatttgccatattccgattg
aaacacgctcgcagcgttgtgaatgttggagaaacagagctatcccatgtgaaagctgtt
atattatctaaacgtcactcaccagaggaactacattccctttttaagtcttcgatatct
gtaacaaacgtgcagatgatgcgccttatattgcagtttctgcaagatataatgcttact
gatatcacatatcgtgaattgtgcgttcgtatgatggagactgcgctggtttatcatcca
gacgaattagttcaatgcttttcttgtgttcacattgcaacactgttcgaaccagaagta
aatgacgatgtaggcggtagattcattagactgttcctgtcttacaaggctacatttggg
gcatgtggcaaacaggatgcaggtgtacctacgtgggttaacagcaaaggatatttctgt
tacgatacagaaaatgctgacacatccgatctcccacctgttccaccacgaatgatttca
tcctataacaactttcaagttgaaacagaaggactggatggtacaaaagtacgtaatgct
aaataccctccctttgccggatcagataataacccctttatcggttatggtagaatagaa
tcattgactcttttgaagatatgtgctgacagagcgggtgtatcgtcagtatttgacatt
cctgcttctagactacgtgattgggtttgtaccatatggtatgaactgcctgcaacacgg
ccatgcttacctttgatgatgacatgcataaattggataaatgcttgtgatgaccctatg
ttcctcaaagatgcagcttttgcgttacttaaaaaggaattgagccttaggggtgatttt
gaaggagggcgactcctgatgttggatcttttatcctttatggcaaaacgctgtggcgtt
gccagtgttgagctcagcaggattgttgacatgttagctgagggagaggacaatatttta
tacgctgtcttagattccattatatcaaacaacttcaccgaagattctatgcttaacctt
tggtgtctattatgcattcttccatggccagtttcttcgccagacagtgcaatatgccgg
ctgctttcatcaacatttttgatctattatcagcttgcctataatgctctaagggatgag
ggaccgtctatacacttcaaaacaaatccaatgggacttatagaaaatgctctgcggata
tgtgtatgccgttgttcgtcaccaatactatcaaaggatgcattattgcagacgatactt
cttgtagaactatcgcctctacccgcggtaaaaatgaccaatgcacctttgattttatcc
agcttatgtccatttctttggaagtgtcactttgtttggtctaattgtggacgtgatgct
gataaggatagcataatcgctttgcgccatctatacaacgttttgcgcacgtgtgtgttt
tgtgaacctttgaacagtgcttctgatgaattggggacccgcaaagtaccaatatttcct
cgtgttcaattcgagtctgatgaaacgatgtccgcagatgttgagagtttcattggggct
tcgaaaacactggacccttcgttgagtgatacccctaatgaagtgatagaggaacaagta
atgcctgaagtaaagattccagtttcgaagacaattttagacagaccacgcggacttcgc
aatttgggtaacacttgttattacaacagtatgctccaagctctgtttcatacacgaggt
tttgttcacggtctgtttgaactatccgaagagaatgattatgtatcggtatataagcgt
atcttccacaaacttatgaagcgtgggaaaaaagtgtttgatcctcgtagtggttataag
atgctcccctctcagtggacatcccgttgtgaacaacaagatgtaactgaaactttagcc
catgttatggaggaacttgatccgacattatcattacgacggcggatattcgctgggtta
gttcttcgtcgtgtgaagtgcctaggatgtggtaatttaagtgacaaccgagaggttgta
atggattttacatttcctgtgaatggtttgcgtagcatacaggccatgtttgatgatttt
tgcaaaatagagacacttcgtggcggtaaccgttatttttgttcgaaatgcgattcctac
cgccgtgcagagatgtggaacgttattgcatcaccacctgcccatttgatgattgttctg
agtcgtcatatgtggcccatgggctccaaagctcaaggagttcactccggtgctggtaaa
ctgctggagcacatcactatcaacgacaagctgcaaatatatgactttgattacactctt
tatgggagtattttccatgttggtgtcgatgcatcatctggtcattactactttgttggt
cgtgatagtgagggctacagcaaatggtacatttgcgatgattctcaggtccgcgaggtt
aacgagacgacggtgaacgacataagccaaaacacgtacaattctgatgtgccatatgtc
ttattttaccgttgtgcccaggctcctcctaccccgctttaa

DBGET integrated database retrieval system