KEGG   Babesia bovis: BBOV_III005520Help
Entry
BBOV_III005520    CDS       T01085                                 

Gene name
17.m07493
Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
bbo  Babesia bovis
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Haem_bd
Motif
Other DBs
NCBI-GeneID: 5479932
NCBI-ProteinID: XP_001611683
UniProt: A7ANI1
Position
3
AA seq 115 aa AA seqDB search
MSKPEPNVTVPDGDAQKGAKLFKSKCAQCHTTNKGGATKQGPNLYGLFGRASGSADYAYT
DANKSSGIVWSDKHLFVYLVNPKEYIPGTKMIFAGLKKEQDRADIIAYLKEATKK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcctgagcctaatgtcactgtgcctgatggcgatgcccaaaagggagctaag
ctattcaagtccaaatgcgcacagtgccacaccacgaataagggtggtgctactaaacaa
ggacctaatctctatggactctttggtagagcatctggttctgctgactacgcatacacc
gacgccaataaatcttctggaattgtatggagtgacaaacacttgttcgtctatctagtg
aaccccaaggagtacatacccggtaccaagatgatcttcgctgggctcaaaaaggagcag
gacagagccgatattattgcttacctcaaggaagccaccaagaagtaa

DBGET integrated database retrieval system