KEGG   Babesia bovis: BBOV_III005520Help
Entry
BBOV_III005520    CDS       T01085                                 

Gene name
17.m07493
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
bbo  Babesia bovis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BBOV_III005520 (17.m07493)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 115 aa AA seqDB search
MSKPEPNVTVPDGDAQKGAKLFKSKCAQCHTTNKGGATKQGPNLYGLFGRASGSADYAYT
DANKSSGIVWSDKHLFVYLVNPKEYIPGTKMIFAGLKKEQDRADIIAYLKEATKK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcctgagcctaatgtcactgtgcctgatggcgatgcccaaaagggagctaag
ctattcaagtccaaatgcgcacagtgccacaccacgaataagggtggtgctactaaacaa
ggacctaatctctatggactctttggtagagcatctggttctgctgactacgcatacacc
gacgccaataaatcttctggaattgtatggagtgacaaacacttgttcgtctatctagtg
aaccccaaggagtacatacccggtaccaagatgatcttcgctgggctcaaaaaggagcag
gacagagccgatattattgcttacctcaaggaagccaccaagaagtaa

DBGET integrated database retrieval system