KEGG   Babesia bovis: BBOV_III006130Help
Entry
BBOV_III006130    CDS       T01085                                 

Gene name
17.m07543
Definition
Ser/Thr protein phosphatase family protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
bbo  Babesia bovis
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    BBOV_III006130 (17.m07543)
Enzymes [BR:bbo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     BBOV_III006130 (17.m07543)
Protein phosphatases and associated proteins [BR:bbo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     BBOV_III006130 (17.m07543)
Transcription machinery [BR:bbo03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     BBOV_III006130 (17.m07543)
Messenger RNA biogenesis [BR:bbo03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     BBOV_III006130 (17.m07543)
Spliceosome [BR:bbo03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    BBOV_III006130 (17.m07543)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 301 aa AA seqDB search
MELDVDSIIARLLEVQGNRPLRTVQLSEDEIKGLCMKSREIFLSESVLLELEAPIKICGD
IHGQYYDLLRLFEYGGFPPASNYLFLGDYVDRGKQSLETICLLLSYKIKYPENFFLLRGN
HECASINRIYGFYDECKRRYSVKLWKVFTDCFNCLPVAAIIDDKIFCMHGGLSPELNSMD
QIRQIARPTDVPDSGLLCDLLWSDPDPNTSGWGENDRGVSFTFGSDIVVNFLIKHELDLI
CRAHQVVEDGYEFFSKRRLVTLFSAPNYCGEFDNAGAMMSVDKTLMCSFQILKPVDRKRL
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggagttggacgtagacagtatcattgcacgccttcttgaagtacaaggaaacagacct
ttacgcacagtacaactcagtgaagacgaaataaaaggcttgtgtatgaaaagccgagaa
atattcctttcagagtcagtgctccttgaacttgaagcacccattaaaatatgcggagat
atacatggacagtactacgacctgctgcgactgttcgagtacggcgggttcccaccggcg
tcaaactatctgtttctcggtgactatgttgatcgtggaaaacaatcactggaaaccata
tgcttgctcttatcgtacaaaatcaagtatccagaaaactttttcttactacgcggtaac
cacgaatgcgcgtctataaacaggatctacggattctatgatgaatgtaaacgacgctac
agcgtcaaactctggaaagtattcacagactgcttcaactgcctgccagtagcagccata
atagatgataaaatattctgtatgcacggaggcttatcaccagaacttaattccatggat
caaatacgccaaattgcaaggccaacggatgtccctgatagtggattactatgcgatcta
ctatggagtgaccctgacccaaatacatcaggttggggcgaaaatgacaggggagtgtct
ttcacattcggctcagatatcgtggtcaacttcctaataaaacacgaactagatcttata
tgccgtgcacatcaggtggtggaagacggctatgagtttttctccaaacgcagactggtg
acactgtttagcgcaccgaactactgcggcgaattcgacaacgcaggagcaatgatgagc
gtagataaaacactcatgtgctccttccaaatactcaaacccgtcgaccgcaagcgactg
aagtaa

DBGET integrated database retrieval system