KEGG   Babesia bovis: BBOV_III006180Help
Entry
BBOV_III006180    CDS       T01085                                 

Gene name
17.m07548
Definition
ubiquitin carboxyl-terminal hydrolase family protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
bbo  Babesia bovis
Brite
Enzymes [BR:bbo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     BBOV_III006180 (17.m07548)
Peptidases [BR:bbo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   BBOV_III006180 (17.m07548)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 713 aa AA seqDB search
MSLESRRGKRFVLQLHDRNISFIKSSEGDEPSDLDQQSVGYFKDGKLHSSGNSKASQDAK
HSFRSTLALIETLQGSDAYGVDMLPSAKRNGQFNKMAGGLHNPGINICFMNVIIQVLTHS
PYLAPAMLRSGHSKVCPNAKRKMVCVTCLLESHIKRALSSPCALKNNFVYIVQKLIWKHY
RLGRQEDAFIFLKHFFEALIKGCYGSKYPYTSSVIIPSKDMMQSFIGRIFGCFLLNVVIC
KVCNYRSEKLETCFDISVDIYRGNKLVDLLSSFVQPELLDSANKYNCPSCKTHQRATKAM
SIYRAPRIMNVVLKRFGMSETGCEKSKKEVSFPLSFSMSLNTSKHPQPVWVTYELYAVVC
HLGRSLNMGHYITFIKGQHGFWHSYNDSTVTTVSQKAVLGLRQDAYLLFYAVKDECVQIC
DMLVNDSAITNSFTSDVVSANRNMGSTLMQYRTDILQAESVAEDSGQQEWPACNIDEGLY
RRVEISKSDDSDTTPGGDPVTIDTSTALCTKPEDATDSPVSGPALEPDLATDTSLEDRHG
GPYELNRIRKRFVTRKRHGYKLRLMHLFRQHQVAAEAVDEIMRIKDRLMQHIHEQGSTSP
EVEVEINPGLLYAKEDNVGTWSDAEPDAAYHELDASIHPPLPKRSQDDIDYDRGKVKKVR
VEPQRPLGMPQIVQHRSGVNITVHQKDAFDRLVNGRHNTLKRGGARFRGRRKR
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagagagcaggcgtggcaagcgctttgtccttcaactacatgatcgcaacatt
agttttatcaagtcttcggaaggtgatgaaccgtctgacttagatcaacagtccgttggt
tattttaaggatgggaaactgcattcttctggtaatagcaaggcatctcaagatgctaag
cattcatttaggtctacgcttgcgttgatagagacacttcagggcagcgatgcttatggc
gtagacatgttacctagcgctaagcgcaatggccagtttaacaagatggctggtggtctt
cataatcctggtattaacatttgcttcatgaatgttattatccaggtacttactcattct
ccctatttggcacctgctatgctgcgttcaggtcactctaaggtctgtcccaatgcgaag
cgtaagatggtttgtgtaacttgtttactagagtcccacataaaacgtgctttgagctct
ccctgtgctttgaaaaataactttgtctacattgtgcagaagttaatttggaagcattat
aggctaggtagacaggaggatgcctttatatttttgaagcatttttttgaggctctcatt
aaaggttgttacggttctaagtacccttacacttctagtgtgataataccttctaaggac
atgatgcagagtttcataggtcgcatctttggttgctttcttttgaatgttgtaatttgc
aaggtctgcaattaccgttcggagaagctcgagacatgttttgacatatcggttgacata
taccgtggtaacaagcttgttgatttgttatcttcgtttgtgcagcctgagttactggac
agtgccaacaagtacaactgtccgtcttgtaagacacatcagcgtgctaccaaggccatg
tctatttatcgtgcacctcgtataatgaatgtagtacttaagcgttttggcatgtctgaa
actggttgtgagaagtctaagaaggaggtatcatttcctttaagtttctctatgtcgttg
aacacctctaagcatccgcagcctgtatgggttacttacgagctttatgctgtcgtatgt
caccttgggagatcattgaacatgggccattacataacgtttattaagggccagcatggc
ttttggcacagctataatgactccactgtgactaccgtatcgcagaaggcggtgctcggc
cttcggcaggatgcctatcttttgttttacgctgttaaggatgagtgcgttcagatttgt
gacatgcttgttaatgacagtgccataactaacagtttcactagtgacgttgtttctgcc
aatcgcaacatgggatctacgttaatgcagtaccgtactgatattcttcaggctgagtct
gtggctgaggactctggtcagcaggagtggcctgcgtgcaacattgacgagggtttgtac
cgtcgtgttgaaatttcaaaatcagatgactccgacaccaccccgggtggtgaccctgtt
actatagacactagcactgctctgtgcaccaaaccagaggatgcaacagactccccggta
tcagggcctgcgctggaacctgaccttgcaaccgacacgtccctggaggaccgccatggc
ggtccttatgaactcaacagaatacgcaagcgcttcgtcaccaggaagaggcacggttac
aaactgaggctaatgcatctcttcaggcaacaccaggttgctgccgaggctgtggatgaa
ataatgcgcatcaaggaccggttgatgcaacacattcacgagcagggtagcacctcgcca
gaggtcgaggtggagatcaaccccgggttgctgtatgccaaggaagacaacgtgggtaca
tggtccgatgcggagcctgatgctgcgtatcacgagctggatgccagcatccacccacca
ctacccaaacggtcccaggatgacatagactacgaccggggcaaggtcaagaaggtacgc
gttgagcctcagaggcctctcggcatgcctcaaatcgtgcagcacaggtctggtgtcaac
attacggtgcatcagaaggacgctttcgatcgactggtgaacgggcgccacaacacgttg
aaacggggtggcgctcgattcaggggtcggcgaaagcgctga

DBGET integrated database retrieval system