KEGG   Babesia bovis: BBOV_III006810Help
Entry
BBOV_III006810    CDS       T01085                                 

Gene name
17.m07603
Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
bbo  Babesia bovis
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:bbo03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:bbo03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 306 aa AA seqDB search
MDDASDTGGSLWPSSSTHIERWVLPSLSHLNSLRENGFNRALERIPTKNDVKLPTFEEEL
WLLRFYTIQLSRFIAANHMKDCVKETALAYFNRFYLRRSMLEHDPRVIMFSCVTLAIKLE
DVWRNYYIDKLLGAVDGLNVLRVFEQESTVCDALDFNFLIIHTSDTMHVLRMRCIEYIKE
TLGIDDIIMGEHLGILLSVCTAAEKDCVVMHEVPELIFVYTPTQLAVGAFSRHCKAKLGS
LISFDGFLLKKLLKDDRSKLTLLTDTINRIVECYDKHFASRSALENEQQKAGEILDMYLA
IYSDTK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgcaagcgatactggtggctcactttggccttccagtagcacgcacatcgaa
agatgggtgctgccttccttatcgcatttaaacagtttacgagaaaatggatttaaccgt
gctctagaacggattcccaccaagaatgatgtgaaactaccaacgtttgaagaagagctg
tggttacttcgtttttacacaattcagttatcgcgatttattgctgctaaccatatgaag
gactgcgtgaaggaaacggctctggcatattttaatcgtttctatctacgccgatctatg
cttgagcatgatcctcgtgttataatgttttcatgcgtaacattggccataaagttggag
gacgtgtggcgcaattattatatagacaagctgctgggtgctgtcgacgggcttaacgtc
ttgcgtgtattcgagcaggagtccactgtatgtgatgccctggacttcaactttttgata
attcacacatctgataccatgcacgtgctacggatgcggtgtattgagtacatcaaggag
actttaggcattgacgatattattatgggcgagcatttagggatccttctttcggtttgc
actgccgctgagaaggattgtgtagtcatgcacgaagttccagagctcatttttgtttat
actcctactcaactagcagtgggtgccttttcacgtcattgcaaagctaagcttggcagt
ttgatttcttttgatgggttcctcctcaagaagctacttaaggacgaccgatccaagcta
acattgcttactgataccattaatcgcatcgtggaatgctacgataagcactttgcttcg
cgttcagcactcgaaaatgagcagcagaaggctggtgagattcttgacatgtatcttgcc
atatatagcgacactaaataa

DBGET integrated database retrieval system