KEGG   Babesia bovis: BBOV_III009120Help
Entry
BBOV_III009120    CDS       T01085                                 

Gene name
17.m07797
Definition
protein kinase domain containing protein
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
bbo  Babesia bovis
Pathway
Regulation of autophagy
Class
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:bbo04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 289 aa AA seqDB search
MEDQVETNIEPVDLGESNREHSPNVKLLFDNCKDGIHMIKDYALLGTLGVGSFGKVKLAI
HCETGQKVAIKIIHKDHNMSTACLSRLGREIRAMSNLRHPNVIYVYEVIDTPSTLFIVME
YVDGRELFDYISQHVRMTETQVIHLMRQLLAAVDFCHSKMVCHRDIKPENIILDKDMNLK
LGDFGLSNFLREGECLRTPCGSPNYASPEVICGKSYSGPEIDIWSCGIVLYVLLCECLPF
DNDEMSVLFLTIKQGKFHLPSHLSKDARWLLQRMLDVNPASRITMRELL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggaggaccaggtggaaaccaatatcgaacccgttgatcttggagagtctaacagggag
cactccccaaacgttaagctactgttcgataattgcaaagatgggatacacatgataaag
gattacgcgttgttagggacacttggagtgggttcctttggcaaggttaaacttgccatc
cactgtgaaaccggccagaaggtagcaatcaagatcatccacaaggaccataacatgtca
acggcgtgtttaagtcgattaggacgagaaattcgtgcaatgtcgaatttgcggcaccca
aatgtaatttatgtctacgaagttattgatacgccttcgacgctgttcattgttatggaa
tatgtcgatggacgtgagcttttcgactacatatcgcaacatgtgaggatgacggagacc
caagtaatccatttgatgcggcagctactggcagcagtagacttctgccacagcaagatg
gtatgccaccgtgatattaagccagagaatatcatattggataaagatatgaatttaaaa
ttaggtgattttggactgtcgaatttcctgagggagggtgaatgcctacgtacaccatgc
gggtccccaaactatgcgtcgccagaggttatttgcggtaaaagctattccggtccggaa
attgacatttggtcctgcggaattgttttgtacgtcctcttgtgtgaatgcctcccgttt
gataacgacgaaatgtctgttttgttcctaaccatcaagcaagggaagttccacttacca
agccatttatccaaagatgcaaggtggctcttgcagcgcatgttagatgtaaatccagcc
tccaggattaccatgcgcgagttgctgtaa

DBGET integrated database retrieval system