KEGG   Babesia bovis: BBOV_III009120Help
Entry
BBOV_III009120    CDS       T01085                                 

Gene name
17.m07797
Definition
protein kinase domain containing protein
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
bbo  Babesia bovis
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    BBOV_III009120 (17.m07797)
Enzymes [BR:bbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     BBOV_III009120 (17.m07797)
Protein kinases [BR:bbo01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   BBOV_III009120 (17.m07797)
Mitochondrial biogenesis [BR:bbo03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    BBOV_III009120 (17.m07797)
  Mitophagy factors
   Other mitophagy factors
    BBOV_III009120 (17.m07797)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 289 aa AA seqDB search
MEDQVETNIEPVDLGESNREHSPNVKLLFDNCKDGIHMIKDYALLGTLGVGSFGKVKLAI
HCETGQKVAIKIIHKDHNMSTACLSRLGREIRAMSNLRHPNVIYVYEVIDTPSTLFIVME
YVDGRELFDYISQHVRMTETQVIHLMRQLLAAVDFCHSKMVCHRDIKPENIILDKDMNLK
LGDFGLSNFLREGECLRTPCGSPNYASPEVICGKSYSGPEIDIWSCGIVLYVLLCECLPF
DNDEMSVLFLTIKQGKFHLPSHLSKDARWLLQRMLDVNPASRITMRELL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggaggaccaggtggaaaccaatatcgaacccgttgatcttggagagtctaacagggag
cactccccaaacgttaagctactgttcgataattgcaaagatgggatacacatgataaag
gattacgcgttgttagggacacttggagtgggttcctttggcaaggttaaacttgccatc
cactgtgaaaccggccagaaggtagcaatcaagatcatccacaaggaccataacatgtca
acggcgtgtttaagtcgattaggacgagaaattcgtgcaatgtcgaatttgcggcaccca
aatgtaatttatgtctacgaagttattgatacgccttcgacgctgttcattgttatggaa
tatgtcgatggacgtgagcttttcgactacatatcgcaacatgtgaggatgacggagacc
caagtaatccatttgatgcggcagctactggcagcagtagacttctgccacagcaagatg
gtatgccaccgtgatattaagccagagaatatcatattggataaagatatgaatttaaaa
ttaggtgattttggactgtcgaatttcctgagggagggtgaatgcctacgtacaccatgc
gggtccccaaactatgcgtcgccagaggttatttgcggtaaaagctattccggtccggaa
attgacatttggtcctgcggaattgttttgtacgtcctcttgtgtgaatgcctcccgttt
gataacgacgaaatgtctgttttgttcctaaccatcaagcaagggaagttccacttacca
agccatttatccaaagatgcaaggtggctcttgcagcgcatgttagatgtaaatccagcc
tccaggattaccatgcgcgagttgctgtaa

DBGET integrated database retrieval system