KEGG   Babesia bovis: BBOV_III010630Help
Entry
BBOV_III010630    CDS       T01085                                 

Gene name
17.m10634
Definition
ubiquitin carboxyl-terminal hydrolase, family 1 protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
bbo  Babesia bovis
Brite
Enzymes [BR:bbo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     BBOV_III010630 (17.m10634)
Peptidases [BR:bbo01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   BBOV_III010630 (17.m10634)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 275 aa AA seqDB search
MVSKLLRKFNKLQIQGVRNMRGDFAPLEACPEVFNNYAEKLGQSNVVFQDLLAWEDWAYN
ELTKPVVGVIVTIPLTPKVIKYLVLDNVSQICRYRDTDAKYTSPKNVSAKVWFARQNLRN
TCGTVALLHLLNNIEDDASVNEDSILEQMRKQSLKASPAERGALIEKTDKIKDLHTSFES
QGQSAYNSDDVDTICHYITFVIVDDDLYELVGTMSSVKYTTQDGTLRFPVNHGRTEPKDL
LRRVEKVVQGSIFALEPDNLQCAAIVASIKPDNEE
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggtatctaagcttctaaggaaattcaataaactgcaaatccaaggcgtacgtaacatg
agaggtgacttcgctccccttgaggcttgccctgaagttttcaacaactatgcggagaaa
ttagggcaaagcaatgtagtatttcaggatttgctagcatgggaagattgggcatacaat
gagcttacgaagcctgtagttggtgttattgtgaccatcccgctcacaccaaaggtaata
aagtacctggtgttagataacgtttcacagatatgccgttatcgcgatactgatgctaaa
tatacatcaccgaaaaatgtgtcagcaaaagtctggtttgcaagacagaatctacggaac
acatgtggaactgtggctttgttacatttgcttaacaatatcgaggatgatgcaagcgtg
aatgaagattctatccttgaacaaatgaggaagcaatcgctgaaggcttcacctgccgaa
agaggagcactgattgaaaagaccgataagatcaaagatctacatacatcatttgaatca
caaggacaatcagcatacaattccgacgatgtagataccatctgccactacattactttt
gttatcgtcgatgatgacctttacgaactggtaggtacaatgtcgtcagttaaatataca
acacaggatggaacactcaggtttcccgtgaaccacggaagaactgagcccaaggacttg
cttaggcgagtagagaaggttgtacaagggagtatattcgcattggagccagataatcta
cagtgtgctgccattgtggcgtcaatcaagccggacaatgaagagtga

DBGET integrated database retrieval system