KEGG   Babesia bovis: BBOV_III010740Help
Entry
BBOV_III010740    CDS       T01085                                 

Gene name
17.m07925
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase family protein (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bbo  Babesia bovis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BBOV_III010740 (17.m07925)
Enzymes [BR:bbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BBOV_III010740 (17.m07925)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 447 aa AA seqDB search
MGKTGRAFEYYSGLDWQCVAKVTSSVGSVIKLLKNACPRKVAVIGSTGSIGCQTLDIIRR
INATYDEPLFDVVALSANCNIKDLAQQAKEFKPKILNINYGYDELRQNVNNDIDITEGKE
GILQLCRNFDYDLLVMGISGCAGIEPTIAAAEAGKSVALANKESVVSAGSTLRRVLDKSK
CELIPIDSEHNAIYQCLVTSPRDLLEHTKERDPRAMCRISTNVLNSVKRLIITSSGGPFR
DTDKSLMKTLRLKDAIKHPVWSMGAKITIDSSTMMNKGLEVIEAHELFGIPYDNIQVVIH
KECIVHSMVQFVDNSVLAQMYNPDMRLPIAYALNWPDRMESTLPELDLLKQQLTFTDPDL
EKFPCLKLAFEAGKMGGLYTTVLNAANERANEFLREDAIAHWEIHELVKRAVEEYKHPNI
DHPRIEDVMEADSWGKNHVMESMKNRH
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaactggaagagcgtttgaatactacagcggtctagactggcaatgtgtcgct
aaggttacaagctctgttggcagcgttatcaaactactgaaaaatgcatgcccacgcaag
gtggccgttataggaagcactggaagcataggttgccaaaccctggacatcattcgtcgc
attaacgcaacatatgatgagccactctttgacgttgtggctctatcagccaactgcaac
attaaagatttggcgcagcaggcaaaggagttcaaacctaagatcttgaatattaactat
ggatatgatgaacttcgccagaacgttaacaatgatatcgacattactgaaggtaaagaa
ggtatactacaactatgtaggaattttgactatgatctattggtcatgggtatatctgga
tgtgccggcattgaaccgaccatagcagcagctgaggcaggtaaaagtgtggctttagct
aacaaagagtctgttgtatcagcaggtagtacactgcgtagagtcctcgataaaagcaag
tgtgaactgatacccatcgattctgaacacaatgctatataccagtgccttgtgacatct
cctagggatctcttagaacacacgaaggaaagggatcccagagctatgtgcaggatatcg
acaaacgttttaaattcggtgaaacgtttgattataactagtagcggcggccctttcagg
gataccgataagtccttaatgaaaacacttcgccttaaggatgccataaaacaccctgtg
tggagtatgggtgcgaaaataactattgattcatccacaatgatgaataaaggtttagag
gtaattgaagctcatgagctttttggaattccgtatgataacattcaagtggtcattcac
aaagaatgcattgtccactcgatggtacaatttgttgataactcggttttggcacaaatg
tacaaccccgatatgaggttacctatcgcatacgctctaaattggcctgataggatggaa
tctacgctcccagaattggatttgctcaagcagcaactgacattcacggaccctgattta
gaaaagttcccttgtcttaagttggcttttgaagccggaaagatgggtggattgtataca
acagttttaaacgcagcaaatgaacgcgctaatgagtttttgagggaagatgcaatagct
cattgggaaatacatgagctggtgaagcgtgcggtagaagagtacaaacatccaaacata
gaccaccctaggattgaggatgtaatggaagctgattcatgggggaagaaccatgttatg
gaatctatgaagaatagacactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system