KEGG   Babesia bovis: BBOV_III011020Help
Entry
BBOV_III011020    CDS       T01085                                 

Gene name
17.m07949
Definition
histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
bbo  Babesia bovis
Brite
Enzymes [BR:bbo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     BBOV_III011020 (17.m07949)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 449 aa AA seqDB search
MEKRVSYFYDPDVGSYYYGPGHPMKPQRIRMAHALVLSYDLYRHMEVFRPHKAVEPELLA
FHDHEYLQFLSGVSPDNYRDFAYQLKRFNVGEATDCPVFDGLYVFQQSCSGASIDGAHRL
NNQQADISINWSGGLHHAKRSEASGFCYLNDIVLAILELLKYHARVMYIDIDVHHGDGVE
EAFYVTHRVMTVSFHKFGNFFPGTGDVTDVGVASGKYYSVNVPLNDGMDDESFVDMFRTV
VGKCVEVYEPGAIVLQCGADSLTGDRLGRFNLTNKGHAGCVAFCRSLNIPLLVLGGGGYT
IRNVARCWAYETGVVLDKHNEMAEQISLNEYYDYYAPDFNLHLQPTNMPNYNTSEHLDRI
KMKIIENLRHVERAPGVQFAHVPNDFFQYDDDEDEAAQLEVFDEGGGVAPAIVPHRKTTP
PIYVNHRLRRKDYKNDYYHLPDRDQHIPI
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggagaagagagtttcttatttttacgacccggatgtgggtagctactactatggacct
ggtcatccgatgaagccacagcgtattcgtatggcacatgctttggtactcagctatgat
ttgtatagacatatggaggtattcagacctcataaggctgttgaacctgaattacttgct
ttccatgaccatgaatatttacaatttctatctggagtaagcccagataactatcgcgac
tttgcataccagcttaagaggtttaacgtaggtgaagctactgactgtccagtatttgat
gggttatatgtattccaacaaagctgcagtggtgcttctattgatggagcacaccgtctg
aataatcaacaggctgatatttccattaattggtctggaggactgcatcatgcaaaacga
tccgaggcttcaggtttctgttatcttaacgatattgtactggctatactggagttattg
aaatatcatgcacgtgtaatgtatattgatattgatgtacatcacggtgatggtgtagaa
gaggcgttctacgttacccatcgtgtgatgactgtcagtttccacaaatttggaaacttc
ttccctggtaccggtgatgttacggatgtaggtgtggcttctgggaagtactatagtgtt
aacgttccgctgaatgatggtatggatgatgaatcgtttgttgacatgtttaggacagtt
gtgggtaaatgtgttgaagtatatgagccgggagctatagtgctacagtgtggagctgac
agtctcacgggcgatcggttaggccgattcaaccttactaacaagggccatgctgggtgc
gttgcgttctgtcgaagcttgaatataccgctgctggtattgggtggaggtggatacaca
attcgtaacgtcgcgaggtgctgggcatatgaaaccggtgtggtactagacaaacataat
gaaatggcggagcaaatatcgttgaacgaatactacgactactacgctcctgatttcaac
ttgcatttgcaacccacgaatatgccgaattataacacgtcggagcaccttgaccgcatt
aagatgaagattattgaaaatctcaggcacgtagaacgtgctccaggggtgcagttcgct
catgtcccaaacgacttcttccagtatgacgacgatgaagatgaggcagcacagttagag
gtgttcgacgaaggtggtggcgtggcaccagccatagtaccacatcgtaaaacaacacct
cccatatatgtcaatcaccgcttacgcaggaaggattataaaaatgattactaccacctt
cctgatagggaccagcatataccgatatag

DBGET integrated database retrieval system