KEGG   Babesia bovis: BBOV_III011150Help
Entry
BBOV_III011150    CDS       T01085                                 

Gene name
17.m10646
Definition
translation initiation factor E4
Orthology
K03259  
translation initiation factor 4E
Organism
bbo  Babesia bovis
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    BBOV_III011150 (17.m10646)
Translation factors [BR:bbo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    BBOV_III011150 (17.m10646)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 242 aa AA seqDB search
MTAPKDSNAGTGPEIDSISPMLTFNKKSEDFKRVAELFETSNVDISTPMPLRNKWVIWEQ
IVKGQDSRNSNDYKCYTKPLVSFDSVQSFWNLWFNIPQPSELSTTQRLSRECTDGSNHIV
DAIMVFRDGIEPMWEDSMNKDGGHFDYRFKPGDVSAATVDEYWNNIVLGLIGCSMPHANL
INGVRLVDKLAGRFPVIRIEVWFQNLGDSNDATQLMKSIGTCMARRLDGSVGVIPKGDLK
WH
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactgctccaaaggatagcaacgccggtaccggaccagaaattgacagtattagtcct
atgctcacattcaacaagaaatctgaagatttcaaacgagtggcggagttattcgaaacg
agcaatgtggatatttctacaccgatgcctctcaggaacaaatgggttatatgggagcag
attgtaaaggggcaagactcaagaaatagcaacgactataaatgttataccaagccactc
gtttcatttgactcagtccagagtttctggaacttgtggtttaacattccccaacccagt
gagctttctacaacgcaacgcctctctcgtgaatgtactgatggctcgaaccatatagtg
gatgccatcatggtattcagggatggaatagagcccatgtgggaagattcaatgaacaag
gatggtggacacttcgattacaggttcaagccaggcgatgtcagtgcagccactgtcgac
gaatattggaacaatatagtgctaggtttaattggatgtagcatgccacacgccaatttg
atcaatggcgtgcgtttggttgacaaacttgcgggaagattccccgtaatacgtatcgaa
gtctggttccagaaccttggagattccaacgatgcgacacagttaatgaaatctatcggt
acatgtatggcccgtcgcctggatggatctgtaggagttattcctaaaggtgacctcaag
tggcattaa

DBGET integrated database retrieval system