KEGG   Babesia bovis: BBOV_IV001070Help
Entry
BBOV_IV001070     CDS       T01085                                 

Gene name
21.m02753
Definition
(RefSeq) protein disulfide-isomerase (EC:5.3.4.1)
  KO
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
bbo  Babesia bovis
Brite
Enzymes [BR:bbo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BBOV_IV001070 (21.m02753)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 531 aa AA seqDB search
MKRLTSLLLPIASWLLATKWANVIVNAYLVIPDPPIAEQLTDDTYDDFLKSTDKTAIVFA
YPSAAVFGHASLSEFAMVSKMLEGNPKCKLGIYQINLTINSPVESMKSTLSYLKDGELVY
MPGDVNKVALIMAWITKERICDPRLQSIESTRYYLRALEPGYVNSLLIMQEDHTDEKLAN
NIYDIILESGYNMGFMIANKNDLVHYAYKMHRLSEESIMPLALMVTRNTPLQHPIKFLWH
NLYNLDKVRTFLDKELVPPVHCTNSFMLDDVMAMNKTMIYLFTKDPNLDEYIDVDWLKKF
ALENNDKFVFIHSKGDDTVEERLNSLLVIDSDYVETAVRAFEIHPGKNEFVKFRPLDDHD
NLITEPHLVKFINDMRDGKIRHFVKSEMPIPERIDVGHVKTIVGEDFHRRVIDSEKDVLI
LFFSPWCGHCHHAKRVFRDLGRRVKGMESVVVAKFDAYNNEVENTTVSEFPTVVLYPHGA
KHQPIQYTGKIVMEDLAHFLETECKKSTISSHAIKRREVDQEQLFERHSEL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggctaacctctttgttattgccaattgctagctggctactggcaacgaaatgg
gcaaatgtgattgttaatgcttatcttgttatcccagacccgccgattgctgaacaattg
acggatgatacatacgatgatttccttaagagtacggacaagaccgccattgtattcgca
tacccttcagctgcagtctttggacatgccagtctcagcgagttcgcaatggtttcaaag
atgctggagggtaaccctaagtgtaaattgggtatataccaaatcaatttgacaatcaac
tcgcccgttgaatctatgaaatctaccttaagctaccttaaagatggagagttggtatac
atgccgggagatgttaacaaagtagctctcattatggcctggattacaaaggaacgtatt
tgtgatccgcgtctacagtcaattgaatcaacgcgttattatctgcgtgcacttgaaccg
ggatatgtcaactctttgttgattatgcaggaagaccacactgatgagaagctggcaaac
aacatttacgacattattttggagagtgggtacaatatgggtttcatgattgcaaacaaa
aatgatcttgttcattatgcatacaagatgcatagactcagtgaagagtccatcatgcct
ttggcattgatggttaccagaaatacacctctgcaacaccctatcaagtttttgtggcat
aacctgtataatttggacaaagttcgtactttcttggacaaggaattggtacctccggtg
cactgcaccaactcattcatgttggacgatgttatggcaatgaacaaaaccatgatctac
ttgttcaccaaggaccctaatttggatgaatatattgatgtggattggcttaaaaagttt
gctctagagaacaacgacaaattcgtatttatccactcaaaaggtgatgatactgttgaa
gaaaggttgaactcactactagttattgatagcgactacgtggaaacggccgtgcgcgct
ttcgaaattcaccctggaaaaaatgaattcgttaagttcagaccactcgatgaccatgat
aatctcatcactgaaccacatttggtcaagttcatcaatgacatgcgcgatgggaaaatc
aggcattttgtgaaatccgaaatgccaattccggaacgtatagatgtaggacacgtgaag
accattgttggggaagatttccaccgcagggttatcgactccgaaaaggatgttttgata
ttgttcttttcaccttggtgtggacactgtcaccacgcaaaacgcgtgttcagagacctt
ggtcgccgcgtgaagggtatggaatcagttgttgtggccaagtttgacgcttacaacaac
gaagttgaaaacacaaccgtatcagaattccctactgtcgttctctatcctcatggagct
aaacatcagccgatacagtacactggtaagattgtcatggaagaccttgcccacttcctg
gaaaccgaatgcaagaaaagtacaattagctcacatgcaatcaagaggcgtgaagtcgat
caagagcagctattcgagaggcactccgagctgtga

DBGET integrated database retrieval system