KEGG   Babesia bovis: BBOV_IV001150Help
Entry
BBOV_IV001150     CDS       T01085                                 

Gene name
21.m03073
Definition
mRNA export protein
Orthology
K14298  
mRNA export factor
Organism
bbo  Babesia bovis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    BBOV_IV001150 (21.m03073)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 359 aa AA seqDB search
MAYSRSSTDDPKTHFLTGIPDDSISHIRWSHSSNPLLLSAGSWDKTVRLWRISPNIGNTL
TSDCVVLYRQEAPILTSCFSDDNTKFFAGGCSNTVMAYDLASRNATGVLVARHDKPVTSI
YWVQKYNALLTASWDGRVCLWDGRQSMPVWFDNVDAKIFAFHFRPNVACAGCHNGKIFVW
NLDDIQHAKNRVMFDSTLRCQIRSISLFPNLTDKGGFIYSSIGGRAVVKHFVEVNRDSTF
TFKCHRQELQNKGGQIYSVNAIDFHNNHGTFVTGGGDGNFVIWDKDNRSRLKQFNNVDAP
VVDVKLHSDTTILAYATSYDWYKGYNQDLLMKTRRQIGVMQLRSEDFKPRPKTVGGGRR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcgtattctcgttcttctacggacgaccctaagactcactttctcactggtattcct
gatgactctatatcgcatattagatggagccattcatctaatccgttactgctttcagcg
ggcagttgggacaagacggttcgtctttggcgcataagtcctaacattggcaacactctt
acatctgactgtgtggttttatatcgtcaggaggctcctatattgacgagttgtttttct
gatgacaatacaaagttttttgctggtggttgttccaacactgtcatggcttatgacctt
gcgagtcgtaacgctactggtgttcttgtagctcgtcatgacaagcctgtgactagtatt
tattgggttcagaagtacaatgctttactgactgctagttgggacggccgtgtttgttta
tgggacggtcgtcagagtatgcctgtatggtttgacaatgtcgatgctaagatttttgca
tttcattttcgtcctaatgtggcatgtgccggttgccataatggaaagatatttgtttgg
aaccttgatgacattcagcatgctaagaaccgtgttatgttcgattctacactaaggtgt
cagattcgttctatatcgttattccccaatctaactgacaagggtggatttatatacagt
tcgattggtggtcgtgcggttgtgaagcactttgtggaggtgaatcgcgattctactttt
actttcaagtgtcatcgtcaagaacttcagaacaagggtggccagatatattctgtgaac
gccattgactttcacaataaccatggtacctttgtcactggtggtggtgacggtaacttt
gttatttgggacaaggacaatcgatctcgtttgaagcagtttaacaacgttgacgctccc
gttgttgacgtgaagctgcattctgacactactatattggcttatgcgactagttatgac
tggtacaagggttacaaccaggatttacttatgaagactcgtagacagattggtgtgatg
cagttacgtagtgaagatttcaagcctcgtcctaagactgttggcggcggtcgtcgttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system