KEGG   Babesia bovis: BBOV_IV001230Help
Entry
BBOV_IV001230     CDS       T01085                                 

Gene name
21.m02985
Definition
protein serine/threonine kinase 1
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
bbo  Babesia bovis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 487 aa AA seqDB search
MPRRRDSRSRRRSSRSYGYRERHRGSIGSGRDYRRGYRRPDRSISRGRYKSRSSSKSRSS
EEFDRVRSRRGSRYTSRRYRRSVSRSSDSSRGRYHGRERSSHDRYRRRHSYRDGHRHTYR
GRHRRSHNRDRPHHKRKASPKDRIIHFSYEPGMHLGDYKVIRKIADGTFGRVLLCEKDGV
QFAVKVVRDVEKYVKSAKIEVEILQDIQKVDGSGESHCVVLHDHFMYKGRIMCLVFERLG
DSLYEFLKANDYKGFFMSDIQRIAFQLLKGLSFLKQNKLIHTDLKPENVLLTCGHDDFIE
VPFPRSTTGMLTKRPATADIKIIDFGSTIYEDDYHSSIINTRQYRSPEVILDLGWSYASD
MWSLGCILVELYTGDLLFGTHSHLEHLAMMERTVGPLPSSMLAEARNTEGRDYLHPTKDS
LNWPEGAQSSSSEERVSCCRSVMEIIRPEHRPFAEFIKYILNPDPSQRPTPEDAMEHEFF
VLTLAEG
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgcaggagggattcgcgcagtcgtcgccgtagttcgcgtagctatggctaccgt
gagcgtcatcgtggtagcataggttcaggtcgtgactaccgtcgtggttaccgtcgacca
gatcgtagtatttccaggggtcgttataaatcacgttcgtcttcaaaatcacggtcttcg
gaagagtttgatcgagtccgttcccgtcgtggcagtaggtatacttcccgtagatatcgt
aggtcagtatcgcgatcgtccgattcatcacgtggtcgttatcacggtcgtgaaagatca
tcccatgaccgatatcgtcgtcgtcactcgtatagggatggccatcgtcatacatatagg
ggccgtcatcgtagatctcataaccgcgatcgtccacatcacaagcggaaggcatctcca
aaggatcgtataatccactttagttatgagcccggtatgcatttaggtgattacaaggtt
atacgtaagatagctgatggtacgttcgggcgtgttctcttatgtgagaaggatggcgtt
caatttgctgttaaggttgttagagacgttgagaagtatgtgaaatcagctaagatagag
gttgaaatactacaagacattcaaaaggtcgacggctctggtgagagccactgcgtcgtt
ttacatgaccatttcatgtacaagggccgcataatgtgcctggtgttcgagcgtttgggc
gattctttatacgagttcctgaaagcgaatgactacaagggtttctttatgtccgacatt
cagcgcatagcattccagttgctgaaggggctatcgtttttgaagcagaacaagttgatt
cacactgacttgaagcctgaaaatgttttattgacctgtggtcatgatgacttcattgag
gtgcctttccctcgttctaccaccggtatgcttacgaagcgtcctgccactgccgatata
aagatcatagattttggcagtactatctacgaggacgactaccacagcagcataattaac
acacgacagtatagatccccggaggtcatcctggacctcgggtggtcatatgccagtgac
atgtggtcactaggttgtatattagttgagctgtacaccggtgacttgctgtttggtact
cacagccacctggagcacttggctatgatggagcgcactgtaggcccgctgccgagctct
atgcttgctgaagcacgtaatactgagggccgtgactatctacatcccactaaggacagt
ttgaattggccagagggggctcaatcaagttcttcggaggaacgtgtatcgtgctgccgc
agtgttatggaaattatacgtccggagcaccggccgttcgccgagttcatcaagtacatt
ttgaaccctgacccatcgcagcgtccaacccccgaggatgccatggagcatgagtttttt
gtccttactcttgctgagggctag

DBGET integrated database retrieval system