KEGG   Babesia bovis: BBOV_IV001730Help
Entry
BBOV_IV001730     CDS       T01085                                 

Gene name
21.m03027
Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
bbo  Babesia bovis
Brite
Enzymes [BR:bbo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     BBOV_IV001730 (21.m03027)
Peptidases [BR:bbo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   BBOV_IV001730 (21.m03027)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1446 aa AA seqDB search
MEQAADHIIPAGLPPLSANEVELLVPNFRRKIITPVSQLQANGDPENKLRELANLNIYSD
WKDLPNMRFRLMLFPVCPHSDSGNTISDIRISAYIECAPKDDWPENWICYGTRFCIFVIH
MNDIQMSLYKKDTFNFSSTESDRGWQGFITHQQIIDGGFLNKNGDLLLRGGVYPMGAEVN
RASRDHTYDCRKATGFVGLQNHGATCYMNALLQSLYSITKFRKTVYLLNFRPDEMIGRRS
YDIMKRLDRSAGGASHTSSYTDTYKNSKRKTHDTSGSINDQDTDLEVVEDPIPDMDLDEN
ECCAILIEEEEEKKKVPSVSLALQNLFYKLRYAPYAPPCKELMRSFGWDSSDMFTQQDSH
ELLKLLLDKMEEQMKGTPVEGSVKNMFEGEMETYIECIDIQYKSCRVETFEDIQLDIQGC
SDIYESLRKLTEAEILDGENMYEAEGHGKQRARKGIRFLKFPPTCVFLLKRFTFDLQRMD
TVKLNDRFEFYKEIDLSPFCSSGGKYVLQAVSVHHGSINSGHYYAFAASSNGEWYRFDDE
TVCKVSEYAVIGDNFGGEEPDCYNYCESEDNASVKAFRRPKNYNAYILIYVLKDAVDDIL
GPCDPVKEHYSMITRCSLEERLYNLRHRVRERLSHFIKVKVFDKSDFVGLKFLDQPFMGW
LGGKTITFARSTSLSDALHQLSIALDIGISDGKGPDNYFIMGLNKATNRFGCLSEIRTSH
NGGSDTLHWLISLIHRDAFQVYDPTLYLLYVPRPPRQSVVTPPQILVFVKYFDIFSDHPD
GDGLICVDVTYVSTNRCISQISGTVLRKVLDMMKQNQVTPYNVSGISRCISRIDSLDTVE
SSISDMDTAVEKIMHDESLHLNWYVELSSLYDAVALNKTLGDQKLAHGNLLVCNFRPTES
MRRAIEEADSKFTQKEDFEPTVPIISDYGNGPFSYQSGDLGAGAPTSLPNLDHTSVMREL
QSRWAMVADKEVIRYQKVNIFPIYDFPSYIDWRLNVVNITFKLYNPLEQLGAWTNCCTSP
VKSDSNISDSNAAFDESNTVMGPIRTMQFTLDLRVPCKHALRYICWSMGVDPAHVLFYSH
HPLKLESIWISPVSLDDFCNRDGSLGFVQKPLSDLFVALGKSVRHDPEYPDAVMRSGSIN
SNAAVSDHSLESDRNPDYNTEVITDSYDHPLPTGQIITLPSNNDSSTDCVDSVRTSRSAD
AGLSSAAVTAFNNNVVKENNVISMAVFPLCYAELLKKCTITSLTFVVQVFNTRVESVGVC
MGHVPVDITVHDFCEVVARHMKLDTSIRWRMIETITDSFAVVDPSSLLGELPQYVNANIR
NLLSAPLRIEPDWSLEEQERLHKSQVVPLTVLHQTPDHETFGHPFQLLVDPYWTLAEIKS
AIKEKLSLPKREWDRWSFFQQMDGYNRSWKANDDRLDWEKSDDIKLLAEHPKPFDKSRSF
CAMRIG
NT seq 4341 nt NT seq  +upstreamnt  +downstreamnt
atggagcaggcggcggaccacattattcctgccggcttaccgccattatcggctaatgag
gttgagttattggtgcctaattttcggcgtaagataattactccggtatcgcagttacag
gccaatggtgaccctgagaacaagcttcgtgagttggcaaacttgaacatttattctgat
tggaaggatcttcctaatatgagatttcgtcttatgttattccctgtttgtcctcacagt
gacagcggcaatactatttccgacattcggatatctgcctatattgagtgtgctccaaag
gacgactggcctgagaactggatatgttacggtactcgtttttgcatttttgtgattcac
atgaatgacattcaaatgtcactttataagaaggatacttttaacttttcttctactgag
tctgaccgtggttggcagggtttcattactcaccagcagattatagacggtggttttttg
aacaagaatggcgatttacttttgcgtggtggtgtttatcctatgggtgctgaggtgaat
cgtgcttctcgtgaccacacatatgactgtcgtaaggctacaggtttcgttggtttgcag
aatcacggcgccacgtgttatatgaatgctcttttacagagtttatatagcattactaaa
tttaggaagactgtatatcttttaaatttccgacctgatgagatgataggccgccgttca
tacgatatcatgaagcgattagacaggtctgctggcggtgcctcccatacatcgtcttac
acagacacatacaaaaacagcaaacgaaagacgcatgacactagcggttcgataaatgac
caggacaccgatttagaggtcgttgaggacccaattcccgatatggaccttgacgagaac
gagtgttgcgctatattgatagaggaggaagaggagaagaagaaggttcccagtgtcagt
ttggcgttacagaatttattttacaagttgcgatatgccccttatgctcctccttgcaag
gaattgatgcgttcatttggttgggattcctctgatatgtttactcagcaggactcccat
gagttattgaagctattgcttgacaagatggaggagcagatgaagggcacgcctgtggaa
ggctctgttaagaacatgtttgaaggggagatggagacctacattgagtgcattgacata
cagtacaagtcatgtcgtgttgagacttttgaggacattcaacttgatattcagggttgt
tctgacatttacgaatcacttcgtaagttgactgaggctgagattcttgatggtgagaac
atgtatgaggctgagggtcatggtaagcagcgtgctcgtaaaggcattcgttttttgaaa
ttcccacccacttgtgtatttttgttgaagcgctttacttttgacttacagcgcatggac
actgtcaagttaaacgaccgttttgagttttataaagagatcgatctatctccattttgt
tcttctggtggcaagtatgttcttcaggctgtatcggttcaccacggttctataaacagt
ggtcattactatgcctttgctgcatctagcaatggtgaatggtatcgttttgacgacgag
accgtttgcaaggtcagtgagtacgcagttattggtgacaactttggtggtgaggagcct
gattgttataactactgtgaatcagaggacaacgcatccgtaaaagcgtttcgtcgtcct
aagaactacaacgcctatatattaatatatgtcctcaaggatgcggttgatgacattttg
ggtccttgtgatcctgttaaggaacactacagcatgataactcgctgctctttggaggaa
cgtctgtataacttacgtcaccgtgtgcgcgaacgtctcagtcattttattaaagtcaag
gtatttgataaaagtgactttgtaggcctcaagtttttagatcagccttttatgggttgg
ttgggtggcaagacaattacctttgctcgttccacaagtctttcggatgccttgcatcag
ttgagcatcgctctggacattggtatcagtgatggcaagggtcctgacaactatttcatt
atgggattgaacaaggctaccaatcgttttggctgtttatctgaaattcgtacttcacac
aatggcgggagtgatactttgcactggttgatttcccttatacatcgtgatgcattccag
gtatatgaccctactctctatcttctttacgtcccaaggcctccacgccaatccgtggtc
actccacctcagattttggtttttgtgaagtactttgacatattttctgatcaccctgat
ggtgacggtttgatttgtgtggatgtaacttatgtttctacaaatcgatgcatttctcag
atatctggcactgtgctacgtaaggtcctagatatgatgaaacagaaccaggtgactcca
tacaatgtatctggtatatcacgttgtatttccaggatcgattccctggacaccgtggag
agctctatctccgatatggacacggctgtggagaaaattatgcacgatgaatcgctacac
ttgaactggtatgtagagctatcaagtctttacgatgcagtggcactgaacaaaactctg
ggcgaccagaagcttgctcatggcaacctattggtttgcaacttccgccctactgaatcc
atgcgccgtgctatagaggaggccgactctaagtttactcaaaaggaggactttgagccc
acggttcctattataagcgactatggcaatggtccattttcatatcagtcaggcgacttg
ggtgctggcgcacccacatcactccctaacctggaccacactagcgtaatgagggaatta
cagtcccgctgggctatggttgctgataaggaggtgatcagataccagaaggtcaacatt
ttcccgatatatgactttcccagttacatcgattggcgtttgaatgttgtaaatataact
ttcaagctctataatcccttggaacaactcggtgcttggactaactgttgcacatctcct
gtgaaatcggacagtaacatctcggatagcaatgctgcctttgacgagtctaatacagtg
atgggtcctataaggactatgcaatttaccctagaccttcgggttccctgtaaacacgct
ttaaggtatatctgttggtccatgggagttgaccccgcccatgtattattctactcccat
catcctttgaaattagaatcaatttggatatctccagtgtcgcttgacgacttttgcaat
cgtgatggatctcttggttttgttcagaagcctctttcggacttgtttgtagcccttggc
aaatcagtgcgtcacgatccggaatatcccgatgcggtgatgcgttccggcagcattaat
agcaatgcagccgttagcgaccacagtcttgaaagtgaccgtaatccggattataatacc
gaggtaattactgattcatatgaccatccgttgcctactggtcagataataactcttccc
agtaacaacgactcgtctactgactgcgtcgacagcgttagaacatctcgttccgctgac
gctgggttaagcagtgcggcggtaaccgcgtttaataacaatgtcgttaaggagaacaac
gtcatatccatggccgtatttcctctgtgctatgccgagttattgaaaaagtgcactatc
acatcgctaacctttgttgtacaagtattcaacactcgggttgaatcggttggtgtttgt
atgggtcatgttcccgtggacattacagtccacgatttctgcgaggtggtagctcgacat
atgaaactggacacttctatccgttggcgcatgattgagactattactgactcttttgct
gtagtggacccttccagtttattgggtgagcttcctcaatatgtgaatgccaacataagg
aatctgttgtcagctcctcttcgtattgagccagactggtctttggaggagcaggagcgc
ctacataagagtcaggtggtacctcttacggtactgcatcaaactcctgaccacgagact
tttggtcacccattccaacttcttgtggacccctattggactttggctgagattaagtct
gctattaaagagaaactatctttacctaagcgtgaatgggaccgttggtccttttttcag
cagatggatggttacaaccgttcgtggaaggccaatgacgaccggttggattgggaaaag
agtgatgacataaagctactggctgagcaccctaagccttttgacaagtcgcgcagtttt
tgtgcgatgcgcatcggttaa

DBGET integrated database retrieval system