KEGG   Babesia bovis: BBOV_IV001820Help
Entry
BBOV_IV001820     CDS       T01085                                 

Gene name
21.m02773
Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
bbo  Babesia bovis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    BBOV_IV001820 (21.m02773)
Exosome [BR:bbo04147]
 Exosomal proteins
  Proteins found in most exosomes
   BBOV_IV001820 (21.m02773)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1676 aa AA seqDB search
MAGAPVKINTLLRLNSLGFKDGCFRFGALTLGGDRFVCIRESDESSHSVSIIDLYNGNEV
SRRPIKAESTIMNPHKPIIALKASIQNGHFIQVFHLETKEKIGTHQFTESVVFWNWISPT
KLGIVTDNSVYHWNIGSEEPVLIFNRSGKLAEPSTKLVDYASDAENKWCILTGVYSTDQG
ATVEGAIQLYSTERRQQQLLEGYAGTFGKLRISTESPDATGLLVFCEHKRGGQTSKLHCM
DVYSQRTEGSPVPLKVSKDIEGLHSNTGDFPRFVHILDSCGFVCIITKCGFAYYHDVATA
TPLYSCKISDSPIFAAAAKYVDGKVAGSIAVNQSGDIIEILIDENRILSTLKCPEEVRIS
LATRFGYPGSESLMMRSFEEYFSRREYKQAALLVATLKNGALRTNETMERFLNAPVLAGE
TSPALHYFSVMLEHGKLTYQESLGLVRRVVAQGRKELVKKWLDEGKLTESEELGDLLRTM
DPLLAFKMFVSLCCHMKAILCLLDAGHATKVVPYIRKIASSNVTHTTGSTGDKVAQVDGL
PSMNVVVEHMLSTQPTDIISFINDLISGLGPDEPLCDVGSVAEILIKHNKLQELTKILLE
YLKPNRVEHAALQTRLLEVNLQQQPRVADMILQLNVLTHFDRAYIARLCEDAGMFDMAIQ
HYNSFFDVKRLIIKAGGNMNRAVLEKSMKNMSPENALEVLREMLDSAEISNDHVVSCALT
MHNHIGTMQVVQLFERSASSDVLFSFLRALPVISQGSAAESTEQNATIVYTFIKCCIDRN
EMEDLERICKESNVYDGVRVKDLLKQSALPNPKSLLIVCHKLGELAELTEYLYRNGMEKA
IEVYVNTINPGGVATVVSTLFDLSASEHVIHSILENLHDPNGMKALIQIADERHQLLMLR
DWLEKRVEEGHKETEIHTALAKIRVSSQKDAEQFLSTNKIYDRSIIGRFCEDRDPMLAYL
VYSEAQLDSDVLRLCIGNGFYKMLAAYALKRSSPSLWHDIFSETSGLDDDNRKHVCEELV
ILAPDSSNASEISCALKALLDAGMNEEVIALLEQLLLKQTQFSSSSNLQNLLLATAVKTN
PSKLEEYLSKLDNYDVAALSKLSDSLGQSRSSFAILKSAGRSLDALEALLSTTDADVLEE
AHEYVQSLDKSELWFRLGRAYLGEKKVAQAIDAYVRSGDLSDHQRIKHACSNEPELFLQW
LSNGRALKKSRDLDTDYLLCLADRGDIDKFKEVLNGQHSADVGYVGSKLMESRKYREAVL
IYSSIPNFAKLALCHLHLGEFYQAADAALNSRNPQVLRQVVEECVGKNQLGTAHKVAIEL
LTYPDFLPGIVTLYETTGNTNELIKLLEKSAPSVAVSTELAIAIAKYKPEELMNHFKTNF
TTEELLVCINTARVARECCNLWLWQEAVYLYSLDTPDTALISMIAHYGLAWDEKLFFETA
ATANNPEALYKAIHFCIQCKPLLLSRLLACAKGRVDAVRVVKILRNAGCLGLARNYLEQV
ADKTSGAVNDALFEIYVEEEECELLERSLEKLTTFDQAKLCAMLQEHRLPKMRSIAAQLY
IQSRDFGKAAVIYRRNGDYVDAIMGVQTSRSESLAMDMVRYFVDQGLLEEFLVCLIVNYS
LLDPADVLEYAWLHKVDMDILVPFLSHTIRTVSKAVSRPAAVQRPPPPPQLSLPFH
NT seq 5031 nt NT seq  +upstreamnt  +downstreamnt
atggcgggagctcctgtgaagataaatactttgcttcggctcaatagccttggcttcaag
gatggttgttttcgctttggggcacttactcttggtggcgataggtttgtgtgtatacgg
gagtctgatgagtcatctcattccgtttctatcatagacttatacaatggtaatgaggta
tctcgcaggcctataaaggccgaatccactattatgaaccctcacaagcccattatcgca
cttaaggcatcgattcaaaatggacactttatccaggttttccatctagagaccaaggag
aagatagggacacaccaattcacagaatcggtagtattttggaattggatttctcctaca
aaacttggtatcgttacggataattcagtttaccactggaatatcggttcggaagaacca
gtgttaattttcaatcgttcaggaaagctagctgaaccttctacaaaacttgtcgattat
gcatctgatgctgaaaacaaatggtgtatattaactggtgtatactctactgatcaagga
gctactgtagaaggtgcaattcaattgtactcaacagagcgaaggcaacagcagctactg
gaagggtacgctggaacgtttggaaagctgcgcatttctactgaatcaccagatgctacg
ggacttttggtattttgcgagcacaaacgcggtggacaaacgtcgaagctccactgcatg
gatgtttacagccaaagaactgaggggtctccggtgccgctgaaggtgtccaaggacatt
gaaggattgcattcaaatactggcgatttccctagattcgtccacatattagattcatgt
gggtttgtttgcataataactaaatgcggcttcgcttattatcatgatgtggcaactgca
acaccactttacagttgtaagataagcgattcaccaatttttgctgccgcagccaagtat
gtagacggtaaggtagctggtagcatagcggtgaatcaatccggggatattattgagata
ctcatagatgaaaatcgcattctttcaactctaaaatgtcctgaagaagtacgtataagt
cttgctacgcgttttggttatcctggttctgagagtttgatgatgcgttcttttgaggag
tacttctcgagaagggagtacaaacaagcagcgttattggttgccacccttaagaatggc
gcattacgaactaatgaaactatggagcgttttttgaatgctccagtattggccggggaa
acatcacccgctttacattatttctcggtaatgttggagcatgggaagctaacatatcag
gaatcgcttggtcttgtacgccgtgtagttgcacagggacgtaaggaacttgtgaaaaag
tggctagacgaaggaaagctaacagagtcagaggaattaggtgacttactacgtactatg
gatccgttgttagcttttaagatgtttgtttccctatgttgtcatatgaaggccattttg
tgtcttttggatgcaggccatgctactaaagtggttccgtacatacgtaaaattgcgtcg
tcgaatgtcacacatacaacgggctccacaggggataaggtagctcaagttgatggattg
ccttcaatgaatgttgttgttgaacatatgttgtcaactcaacctaccgatataatatcg
tttattaacgatttgatatcaggtttagggcctgacgagcccttatgcgatgttgggagc
gtcgctgagatccttattaagcacaacaaacttcaagaattaaccaagatcttacttgaa
tacttgaaacccaaccgcgttgagcacgctgcgctacaaacacgtctgttagaggtgaat
ctccagcagcaaccccgtgtagctgatatgatactacaattgaacgtgctaacccatttt
gaccgagcgtatattgctcgcctttgtgaagatgcgggaatgtttgatatggctatacaa
cactataactcattttttgacgttaaacgtctcataattaaggctggtggtaatatgaat
cgcgctgttcttgagaagagtatgaagaatatgtctccggaaaatgctctggaggtttta
cgcgagatgttagattctgcagaaataagcaacgatcatgttgtatcttgtgctttgaca
atgcataatcacattggaactatgcaggtggtccaattgttcgagagatcagcatcgtcc
gatgttctattctcattcctaagggcgttgccggtgatatcacagggatctgccgccgag
agcaccgagcaaaatgcaaccattgtatatacattcattaaatgttgtattgatcgcaac
gagatggaggatttggaacgtatttgcaaagagtcaaatgtttatgatggcgtgcgtgtc
aaggatttactgaagcaatcggctcttccaaatccaaagagcttactcatagtttgtcac
aagctaggcgaattggcagagctcacagaatatctataccgcaatggtatggaaaaggct
atagaggtttatgtaaacacaataaaccctggaggtgtagctactgttgtgtcaaccttg
tttgatttatcggcatcggagcacgtgatacattcaattttggagaaccttcacgatcca
aacggtatgaaagctttgattcagatagctgatgaacgtcatcagcttcttatgcttcgt
gattggttagaaaaacgtgtagaggaaggtcacaaagaaacggagatccatactgcatta
gctaagattcgagtatcatcgcaaaaggatgcggagcagtttctttccacaaataagatt
tacgaccgatccattattggacgtttttgtgaggatagagaccctatgctagcatatttg
gtatattccgaggcacagcttgacagcgatgtattgcggctatgcataggcaatgggttt
tataaaatgctggctgcatatgctttgaaacgatcatcacctagtttatggcatgatata
ttttctgagacctctggtttggatgacgataacagaaaacacgtttgcgaagagttggtc
attttggcgcctgactcttccaatgcatctgaaatttcatgtgcgctgaaggctctgtta
gatgctggtatgaacgaagaagtcattgcactcttggagcagcttttactcaaacagacc
cagttttcatcaagcagcaatttgcaaaatttgcttttagctacagctgttaaaacgaat
ccctcaaagttagaggagtatctctcaaaactggacaactacgatgttgcggcattatct
aaattatctgacagcttgggtcaatcacgaagttcgtttgcaattttaaagagtgctggt
cgttctctggatgctttagaagctttgctaagcactacggacgccgacgtattggaagaa
gctcatgaatatgtacagtctctagacaagtctgagttatggttccgcctgggtcgggca
tatttgggagagaagaaggtggcgcaggctattgatgcttacgttcgcagtggtgacttg
agtgaccaccaacgcatcaaacatgcgtgttccaacgagccagagctgttcctacaatgg
ctgagcaatgggagagcactgaagaaaagccgtgacctcgatacggattacttgttatgt
ctggctgacaggggtgacattgacaaattcaaggaagttcttaacggccagcattcagca
gatgtgggatatgtaggcagcaagttgatggaatcgcgcaagtaccgtgaagctgtactc
atttattcttctataccaaattttgccaagctagctctgtgccatctacatttaggcgag
ttctaccaagcagcagatgctgctctcaactcccgtaacccgcaggttctcagacaggtg
gtcgaggagtgtgttggtaagaatcaattaggaaccgctcacaaggtggctatcgaatta
ttaacgtaccctgatttcttgcctggtattgtcacactgtacgaaactactggaaataca
aacgaattgatcaagctattggaaaaatcagctccttccgttgcagtatcaactgagttg
gcaattgccattgcaaaatacaagcccgaggagttaatgaatcatttcaagactaatttt
acgactgaagaacttctcgtttgtataaatacggcacgcgttgcacgtgaatgttgtaac
ctttggttgtggcaggaagctgtttacctctacagtttggacacacctgataccgcttta
atttccatgattgcgcactacggtctggcgtgggatgaaaaactattttttgaaactgcg
gcaacagctaacaatccggaagctttatataaggcaattcatttctgtatacaatgcaaa
ccccttttactatcaaggttgctggcttgtgctaaagggcgagttgatgctgttcgcgtg
gttaagattttgaggaatgctggatgtctcggattagcacgtaattacctggaacaagtc
gctgataaaacatccggagcagtgaacgatgcactgtttgaaatatacgtggaggaggaa
gagtgtgaacttttggagcgaagtttagaaaaacttactacttttgaccaagcaaagtta
tgtgcaatgctgcaggagcatcgtcttccgaagatgaggagcatcgcagctcagttgtac
attcagtctcgtgactttggcaaggctgcagtcatttatcgtagaaatggcgattatgtt
gatgctataatgggtgttcagacatctcgtagcgaatctcttgcgatggatatggttcgt
tatttcgtcgatcagggattactcgaagaatttttagtttgtttgattgtaaactattct
ttactcgatccagcagatgtcttagagtatgcctggctgcacaaagttgatatggacatt
cttgttcctttcttgtctcatactatacgtaccgtatctaaggctgtgtctaggcctgct
gcagttcagcgtccaccacctcctccgcagctatctttgccttttcattga

DBGET integrated database retrieval system