KEGG   Babesia bovis: BBOV_IV002330Help
Entry
BBOV_IV002330     CDS       T01085                                 

Gene name
21.m03010
Definition
protein disulfide-isomerase (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
bbo  Babesia bovis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    BBOV_IV002330 (21.m03010)
Enzymes [BR:bbo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BBOV_IV002330 (21.m03010)
Exosome [BR:bbo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BBOV_IV002330 (21.m03010)
  Exosomal proteins of colorectal cancer cells
   BBOV_IV002330 (21.m03010)
  Exosomal proteins of bladder cancer cells
   BBOV_IV002330 (21.m03010)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 463 aa AA seqDB search
MDFRSALALVCSLISLGFASATSENGPSAVVELTEHTIHKFISDNDAVLVKFYAPWCMHC
QSLAPEYEKAAKQLSEEGSEIILAELNCDGAPTVAQEFGIEGYPTIKFFRKGNPREYDGT
RQADGIVSWCKDILLPAVVRVVSADDIIHEADIIFVASGHDSSEELMQEYENLADIHRSD
ATFYFVHQGKKEIYVMHRGNDRFEFTGSTVEELVEFVRQESLPLFAEIGHANYVRYFNSG
KAISWFCATQADYDKYRSTFISVARKLRASVLFAWLDVEKFTAAKEAFAIESFPAVAHQT
NAGRYILLPEVYPYDDVEAVIRFYSDVEAGKVPRSIKSEAEPTSNDGPVVTLVGKTLTSY
VQNASKPILLMIHSPFCEHCKKFMPVFTSFGETMGSDGRVSVALLNGDANESELEFIQWT
AYPTVLLIKPGGTDVMSYEGKRTLEDLTSFVEKHVADQRHEEF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggatttccgcagcgctttggcgctagtgtgctcattgattagcctgggcttcgccagc
gctacaagtgaaaatgggccctcggcagtcgttgaattgaccgaacataccatccacaag
ttcatttctgataatgatgctgtcttggttaagttctatgctccatggtgtatgcactgc
cagtcattggcaccggaatatgagaaggccgccaaacaactatcggaagaaggtagcgaa
atcattttggccgaattgaactgtgacggcgctcccactgttgcacaagagttcggtatt
gaaggatacccaaccatcaagttcttccgtaaaggtaaccctcgtgaatacgatggtaca
cgccaagccgacggaatcgtatcatggtgcaaggatatcctactgccagctgtagtcagg
gtggtaagcgctgacgatatcattcatgaagcagatatcatcttcgtcgcctccggccac
gatagcagcgaggagcttatgcaggagtatgaaaatttggctgatatccaccgtagtgat
gctaccttctattttgtacaccagggtaagaaggaaatctacgtgatgcacagaggcaac
gaccgtttcgagttcaccggctcaacagttgaagagttggttgaattcgtaagacaggag
agcctgcccctctttgctgagattggtcacgccaactatgtgcgttacttcaactctggc
aaggccatatcgtggttctgcgccacccaggctgactacgataaataccgtagtaccttc
atctccgtcgcacgtaaattgcgcgctagcgtactattcgcgtggctcgatgtcgagaaa
ttcactgctgccaaagaggcatttgccatagaatccttccccgccgtagcacaccagacc
aatgccggcaggtacatccttctcccagaggtctacccctacgacgacgttgaggcagtg
atacgcttctactccgatgtagaggctggtaaagtaccacgcagcattaagagtgaagcc
gaacccactagcaacgacggccccgtagtcacacttgttggtaaaacactcaccagctac
gtacaaaacgcatctaaaccaatattgctcatgatccactcaccattctgtgaacattgc
aagaagttcatgccagtatttacatcattcggtgaaaccatgggatctgacggacgcgtc
agcgtagcactactcaacggtgacgccaacgaatctgaacttgaattcatccaatggacc
gcttacccaaccgtcctactcatcaaaccaggtggcactgatgtcatgtcctacgagggc
aaacgcacactcgaggatctcacatccttcgtagaaaagcatgtcgccgaccagcgccat
gaagaattctaa

DBGET integrated database retrieval system