KEGG   Babesia bovis: BBOV_IV002330Help
Entry
BBOV_IV002330     CDS       T01085                                 

Gene name
21.m03010
Definition
protein disulfide-isomerase (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
bbo  Babesia bovis
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:bbo04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 463 aa AA seqDB search
MDFRSALALVCSLISLGFASATSENGPSAVVELTEHTIHKFISDNDAVLVKFYAPWCMHC
QSLAPEYEKAAKQLSEEGSEIILAELNCDGAPTVAQEFGIEGYPTIKFFRKGNPREYDGT
RQADGIVSWCKDILLPAVVRVVSADDIIHEADIIFVASGHDSSEELMQEYENLADIHRSD
ATFYFVHQGKKEIYVMHRGNDRFEFTGSTVEELVEFVRQESLPLFAEIGHANYVRYFNSG
KAISWFCATQADYDKYRSTFISVARKLRASVLFAWLDVEKFTAAKEAFAIESFPAVAHQT
NAGRYILLPEVYPYDDVEAVIRFYSDVEAGKVPRSIKSEAEPTSNDGPVVTLVGKTLTSY
VQNASKPILLMIHSPFCEHCKKFMPVFTSFGETMGSDGRVSVALLNGDANESELEFIQWT
AYPTVLLIKPGGTDVMSYEGKRTLEDLTSFVEKHVADQRHEEF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggatttccgcagcgctttggcgctagtgtgctcattgattagcctgggcttcgccagc
gctacaagtgaaaatgggccctcggcagtcgttgaattgaccgaacataccatccacaag
ttcatttctgataatgatgctgtcttggttaagttctatgctccatggtgtatgcactgc
cagtcattggcaccggaatatgagaaggccgccaaacaactatcggaagaaggtagcgaa
atcattttggccgaattgaactgtgacggcgctcccactgttgcacaagagttcggtatt
gaaggatacccaaccatcaagttcttccgtaaaggtaaccctcgtgaatacgatggtaca
cgccaagccgacggaatcgtatcatggtgcaaggatatcctactgccagctgtagtcagg
gtggtaagcgctgacgatatcattcatgaagcagatatcatcttcgtcgcctccggccac
gatagcagcgaggagcttatgcaggagtatgaaaatttggctgatatccaccgtagtgat
gctaccttctattttgtacaccagggtaagaaggaaatctacgtgatgcacagaggcaac
gaccgtttcgagttcaccggctcaacagttgaagagttggttgaattcgtaagacaggag
agcctgcccctctttgctgagattggtcacgccaactatgtgcgttacttcaactctggc
aaggccatatcgtggttctgcgccacccaggctgactacgataaataccgtagtaccttc
atctccgtcgcacgtaaattgcgcgctagcgtactattcgcgtggctcgatgtcgagaaa
ttcactgctgccaaagaggcatttgccatagaatccttccccgccgtagcacaccagacc
aatgccggcaggtacatccttctcccagaggtctacccctacgacgacgttgaggcagtg
atacgcttctactccgatgtagaggctggtaaagtaccacgcagcattaagagtgaagcc
gaacccactagcaacgacggccccgtagtcacacttgttggtaaaacactcaccagctac
gtacaaaacgcatctaaaccaatattgctcatgatccactcaccattctgtgaacattgc
aagaagttcatgccagtatttacatcattcggtgaaaccatgggatctgacggacgcgtc
agcgtagcactactcaacggtgacgccaacgaatctgaacttgaattcatccaatggacc
gcttacccaaccgtcctactcatcaaaccaggtggcactgatgtcatgtcctacgagggc
aaacgcacactcgaggatctcacatccttcgtagaaaagcatgtcgccgaccagcgccat
gaagaattctaa

DBGET integrated database retrieval system