KEGG   Babesia bovis: BBOV_IV004350Help
Entry
BBOV_IV004350     CDS       T01085                                 

Gene name
23.m05773
Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.1.2.15)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
bbo  Babesia bovis
Brite
Enzymes [BR:bbo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     BBOV_IV004350 (23.m05773)
Peptidases [BR:bbo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   BBOV_IV004350 (23.m05773)
Exosome [BR:bbo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BBOV_IV004350 (23.m05773)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 790 aa AA seqDB search
MKEAEPLAKLAQTSGLKTPSRSTAVHKDECIYSTDTDKSPDGIYINLKSFESFGKGVLHL
DTSGDNAIYLHVKRVLVPVNPEVNYSEDVTLDKVDSSTAINKEPGSTTNETAIVYKQKKT
CDEVVEYEIYCPSLGLTVPLESAPQGLATICKAVIDHEAFNFNPDEFVWKDYLNESKYAE
HLIQVEAPPVIKYENLVCDRCGAATNLWLNLSDGYIGCGRKNYDSGGCADGEEGAAIQHY
NETGGIYPLAVKVGTITATSGDVFSYAADEDCLVTDPYLSVHLAHFGIDVSNLTKTEKTT
AQLEIEKNEQHDWSEMGNGKSQVAQGPGLIGLENLGNTCYLNSAVQVLASVPELAKYFVE
NIESIATEVPEGTQPCGDVLLQFAKIVKALTTDRVVEQQRELLSRYRKACEEMGINYEEP
EQLKNVAVKPSMLKYAIGRDNQRFATGDQQDAEEFFSHLLNTLVDMETEVKRRTKTNFKL
KSFFFFKYRQYLVCESLNKMTYNDNEMHMLCLPLILQSETMELDPTVEINLQHCVSNWER
EQEIDYIDQGKHHVGVITNALVTLPQYLVIKVDRFFYNMDGTSKKIVNPVVVPQEGIVLE
TQGEVDHKGYIVECNTREPKKAKHQGNDTLLQQLMAMGFQEKLCRLAMEREGNDNIDTCV
NWILSNMDVVSEDTPDDKAGVVATNASILMDLGYPLELANRAAEKFGDDLAAAVDWLATE
DFAPTTQVKQKGRYKLWAVISHIGESINTGHYVCHITKHGHWYTYNDAKVLTCDSAPTNN
GYLYLFSRLE
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagctgagccactcgctaagctagctcaaaccagtggattgaagacaccgagt
cgtagtacagcagtacacaaagatgaatgtatatacagcactgataccgataaatcgcca
gacggcatctatataaacctgaaatcatttgaatcatttgggaaaggggtccttcatctt
gatacatctggtgacaatgcgatttatctacatgtaaagcgagttctagtccccgtcaac
ccagaggttaattacagcgaggacgtcacacttgataaggtggatagtagcactgcgatt
aacaaggagccaggaagtactacgaatgaaacagctatagtgtacaagcaaaagaagaca
tgcgatgaagtcgtggagtatgagatatactgcccatcgctaggactcacggtgccccta
gagagtgcaccgcagggtctagctacaatttgcaaagccgttatagaccatgaagcattc
aactttaaccctgatgagtttgtttggaaggactatttgaacgagtccaagtatgcagag
catctaatacaagtagaagcaccaccggtgatcaagtacgagaacttggtctgcgaccgc
tgtggagctgctactaacctatggcttaatttatctgatgggtatattggctgtggtcgt
aaaaactatgactccggaggctgcgctgatggagaggaaggtgctgcaatccagcattac
aatgaaacgggtggtatatacccactggcagtgaaagtgggtaccatcactgccacttcg
ggtgatgtgttcagctacgcagccgatgaggactgcttggtaactgacccttacctcagt
gtccacctagcccactttggtatagacgtctctaacttgaccaaaaccgagaaaacaacg
gcacaattggaaattgagaagaatgaacagcatgattggtccgaaatgggcaatgggaag
tcacaagtggcacaaggaccgggattaatcggtctagagaacctggggaatacatgctac
ctcaattcggcagtgcaggtactggcatcagtacctgaactagcgaagtacttcgtggaa
aacattgaaagcatcgcaactgaggtgccagaaggtacccaaccgtgcggtgatgtgttg
ttgcaatttgcaaagatagtcaaggcgttgaccacggatcgcgtggtagagcagcaacgt
gaactattatccagatatcgcaaagcttgtgaagagatgggaattaattacgaagaaccg
gaacaattgaaaaacgtagctgtgaagccatcaatgttaaagtatgccattggcagggac
aaccagaggtttgccacaggtgaccaacaggatgcagaggaattcttcagccacctcctg
aatacgcttgttgatatggaaacagaagtaaaacgacgtacaaaaacaaactttaaactg
aagtcattctttttcttcaagtataggcagtacctggtctgcgaaagcttgaataagatg
acctacaacgacaatgagatgcatatgctatgtctaccgttgatcctacaatccgaaaca
atggaattggaccctacagtcgaaattaacctacagcactgcgtaagcaactgggagcgt
gaacaggagattgactacattgaccagggcaaacaccacgtaggggtgatcactaacgca
ctagtgacgttaccacagtacctcgtgataaaggtcgaccgtttcttctataacatggat
ggaactagtaagaaaatagtgaaccccgttgtggtaccacaggagggcattgtactagaa
acacaaggtgaagtggaccacaaaggatatatcgttgaatgcaatacacgcgaacctaaa
aaggccaaacatcaaggaaatgacacattgttgcaacagctgatggccatgggattccag
gaaaagctatgtagattggccatggaaagagaagggaatgacaacatagatacatgcgtg
aactggatactatccaacatggacgtagtctcagaggatacgccagacgacaaagctgga
gtagttgccaccaacgcttcgatactgatggacctgggatacccactggagctggcaaac
agagctgccgagaagtttggagatgacctggctgccgccgtggactggctggcaacggag
gatttcgcccctaccacacaggtgaagcaaaagggaagatacaagctctgggcagttata
tcgcatataggagaaagtatcaatacggggcattacgtatgccacataacgaaacatggg
cactggtatacctacaatgacgccaaagtgctaacttgtgacagtgcaccaaccaataat
gggtacctatacctatttagtaggttggaataa

DBGET integrated database retrieval system