KEGG   Babesia bovis: BBOV_IV004840Help
Entry
BBOV_IV004840     CDS       T01085                                 

Gene name
23.m06243
Definition
(RefSeq) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bbo  Babesia bovis
Pathway
bbo00020  Citrate cycle (TCA cycle)
bbo00310  Lysine degradation
bbo01100  Metabolic pathways
bbo01110  Biosynthesis of secondary metabolites
bbo01130  Biosynthesis of antibiotics
bbo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBOV_IV004840 (23.m06243)
  Amino acid metabolism
   00310 Lysine degradation
    BBOV_IV004840 (23.m06243)
Enzymes [BR:bbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BBOV_IV004840 (23.m06243)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl GCV_H
Motif
Other DBs
NCBI-GeneID: 5478647
NCBI-ProteinID: XP_001610413
UniProt: A7AQM6
Position
4
AA seq 402 aa AA seqDB search
MVSCSSLIGAVMRRCVPGPLASYRLLSKIPGGCGVLDRHFNGFRSLHVSSTLLEVKTMKL
PSLGDSISEGTLSEWKKNVGESVEVDEPIAIVETDKVTVDINSTLSGVIVKQHYEVDDTV
LVGKPFIDVDAGGSAAAPAETASGVDSKSPEPVAEVKADEPAPTETRVCYQLSLHNVQVQ
MTRMRKRIGERLKESQQTTVMLSTFNECDMDAIMALRKELNESGKYPVKLGYVSAYMKAS
TMALLKMPIMNSYIEGDDIVTKHFVDISVAVATPTGLVVPVIRNCEGKSWIELEQQLVDA
AAKGREGRLTVADMTGGTFTISNGGVYGSVLSTPIINPPQSSILGMHSIIKRCVVRDDQM
VIRPIMNLALSYDHRLIDGREAVQFLIAIKEAIENPKVLLEN
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcatgttctagtttaattggtgcggttatgcgccgttgtgtacccggaccttta
gcttcctatcgacttttatctaagatacctggaggatgcggtgtgttagatcgtcatttc
aatggcttccgcagtctccatgtgtcttctactcttctggaagttaagactatgaaattg
ccatctcttggtgactccatcagtgagggcacactaagtgagtggaagaagaacgtgggt
gaatcagtggaagtcgacgagccaattgccatagtggagacggacaaggtcactgttgac
attaacagtacattatctggtgtaattgttaagcaacactatgaagtcgacgacactgtg
cttgtcggcaagcctttcatcgacgttgacgctggcggctccgccgccgctcctgcggag
actgcatctggtgttgactcaaaatcaccggaacccgtcgctgaggttaaagctgatgaa
ccagctccaacagaaactagggtatgttaccagctatctttgcataatgttcaggtacaa
atgacccgtatgcgcaaacgcattggcgagcgtcttaaggaatctcagcagactaccgtc
atgttaagtacgttcaacgagtgtgacatggatgctataatggcccttcgtaaggagttg
aatgaatctgggaagtaccctgttaagctgggatacgtctcagcctacatgaaggcttcc
actatggcgttactcaagatgcccataatgaactcctacattgagggtgatgacatcgtg
acaaagcactttgttgacatctcagttgcagtggctacgcccacgggcttggtggtacct
gtcattcgtaactgcgagggcaagagctggatagagcttgaacagcagttagttgatgcc
gccgccaagggtcgtgagggacgccttacagtggccgacatgaccggcggtaccttcacc
atatccaacggcggtgtctacggcagtgtgctaagcaccccaatcattaacccacctcag
tcatccattttgggtatgcactcaatcattaaacgctgcgtcgtgcgtgacgaccagatg
gtcatacgtccaataatgaacttggccctgtcttacgaccaccgtttgattgacggccgt
gaggccgtgcagttcctaattgcaattaaagaagccattgaaaacccgaaggtcttacta
gaaaactaa

DBGET integrated database retrieval system