KEGG   Babesia bovis: BBOV_IV004840Help
Entry
BBOV_IV004840     CDS       T01085                                 

Gene name
23.m06243
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bbo  Babesia bovis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bbo01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bbo00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bbo00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 402 aa AA seqDB search
MVSCSSLIGAVMRRCVPGPLASYRLLSKIPGGCGVLDRHFNGFRSLHVSSTLLEVKTMKL
PSLGDSISEGTLSEWKKNVGESVEVDEPIAIVETDKVTVDINSTLSGVIVKQHYEVDDTV
LVGKPFIDVDAGGSAAAPAETASGVDSKSPEPVAEVKADEPAPTETRVCYQLSLHNVQVQ
MTRMRKRIGERLKESQQTTVMLSTFNECDMDAIMALRKELNESGKYPVKLGYVSAYMKAS
TMALLKMPIMNSYIEGDDIVTKHFVDISVAVATPTGLVVPVIRNCEGKSWIELEQQLVDA
AAKGREGRLTVADMTGGTFTISNGGVYGSVLSTPIINPPQSSILGMHSIIKRCVVRDDQM
VIRPIMNLALSYDHRLIDGREAVQFLIAIKEAIENPKVLLEN
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcatgttctagtttaattggtgcggttatgcgccgttgtgtacccggaccttta
gcttcctatcgacttttatctaagatacctggaggatgcggtgtgttagatcgtcatttc
aatggcttccgcagtctccatgtgtcttctactcttctggaagttaagactatgaaattg
ccatctcttggtgactccatcagtgagggcacactaagtgagtggaagaagaacgtgggt
gaatcagtggaagtcgacgagccaattgccatagtggagacggacaaggtcactgttgac
attaacagtacattatctggtgtaattgttaagcaacactatgaagtcgacgacactgtg
cttgtcggcaagcctttcatcgacgttgacgctggcggctccgccgccgctcctgcggag
actgcatctggtgttgactcaaaatcaccggaacccgtcgctgaggttaaagctgatgaa
ccagctccaacagaaactagggtatgttaccagctatctttgcataatgttcaggtacaa
atgacccgtatgcgcaaacgcattggcgagcgtcttaaggaatctcagcagactaccgtc
atgttaagtacgttcaacgagtgtgacatggatgctataatggcccttcgtaaggagttg
aatgaatctgggaagtaccctgttaagctgggatacgtctcagcctacatgaaggcttcc
actatggcgttactcaagatgcccataatgaactcctacattgagggtgatgacatcgtg
acaaagcactttgttgacatctcagttgcagtggctacgcccacgggcttggtggtacct
gtcattcgtaactgcgagggcaagagctggatagagcttgaacagcagttagttgatgcc
gccgccaagggtcgtgagggacgccttacagtggccgacatgaccggcggtaccttcacc
atatccaacggcggtgtctacggcagtgtgctaagcaccccaatcattaacccacctcag
tcatccattttgggtatgcactcaatcattaaacgctgcgtcgtgcgtgacgaccagatg
gtcatacgtccaataatgaacttggccctgtcttacgaccaccgtttgattgacggccgt
gaggccgtgcagttcctaattgcaattaaagaagccattgaaaacccgaaggtcttacta
gaaaactaa

DBGET integrated database retrieval system