KEGG   Babesia bovis: BBOV_IV005520Help
Entry
BBOV_IV005520     CDS       T01085                                 

Gene name
23.m06268
Definition
mitogen-activated protein kinase
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
bbo  Babesia bovis
Brite
Enzymes [BR:bbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     BBOV_IV005520 (23.m06268)
Protein kinases [BR:bbo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   BBOV_IV005520 (23.m06268)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 584 aa AA seqDB search
MTGIGHDKMVVEERMQDVSHNDGQTMYYPEMRDRMPSHNANNEIGGNKVIKAQGALIARR
ISSADTEVPSTLFRRMSSVGKSYNDEGHSLPSLNQPRKPCGLSASAREPPRDYFMDRNVK
SSYPVTDERRLRNPPLKNKSTTFKPSLSNNNVVWDLPDKYKVIDIVGSGSYGQVCRAFDI
ENQRYVAIKRIHKVFEDLIDCKRILREIAILNRLDHPNVVKVLDIVIPSDLENFNVLYVV
LEIAASDIKLLIRSPAFLNDSHIKLIMYNLLCGVYYLHARGIYHRDLKPANCLVNRDCSV
KICDFGLARTIAQPVTQAPLGKHCSFTAREVEDEMCQVGVRNLPNSARLVDYNDELAHFQ
RKRMNVSHSRQLTGHVVTRWYRAPELILLQDNYTAAIDVWSVGCIFAELLNMVKGNMSDV
SQRSPLFPGTSCFPLSPDNKNPSDKAKEHDQLNIIFNVIGTPCEEDIAAIIKPEVRRYIR
MFHPRKGIDLYKRFKGTPPAAVNLLQQMLTFNPYKRITVAEALKHEYFREFYKPQHVEIP
TEQLVTPFNDWINMSESQLRYAFLREIQRYHPEFKIPLKIIYKP
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcattggacatgataagatggtagtggaagagcgaatgcaggatgtatcgcat
aatgatggacaaacaatgtactaccccgaaatgagggatcgtatgccctcacataacgcc
aataatgaaattggtggaaacaaagtaatcaaggcgcagggcgcccttatcgcacggagg
atcagctcggcggataccgaggttccttccacccttttcagacgtatgtcaagtgtaggt
aaaagctacaatgatgaaggacattcattgccatcgttaaatcagccacgtaagccttgt
ggacttagtgcatcagctcgtgaaccgccacgtgactacttcatggataggaatgttaaa
tcgagttatccagtaacagatgaaaggcgcttacgtaacccgccactaaaaaacaagtca
acgactttcaagcccagtctatcaaacaataacgtggtgtgggatctcccagataaatat
aaggtaattgacattgtaggctcagggtcttatgggcaggtctgccgtgcctttgatata
gaaaatcaacgttatgtagctattaagcggatacataaggtgttcgaggacctgatagat
tgtaagaggatcttaagggaaatagccatacttaatcgattggatcacccaaatgttgtc
aaggtactggatattgttataccaagtgacttggaaaactttaatgtgctgtatgtggta
ctggagatagcagcctcggatatcaaactgctcataaggtcgcccgcatttctcaatgat
agccatatcaagctgataatgtataatctgttgtgtggcgtgtactacttacacgcacga
ggaatatatcaccgcgatttgaaaccggccaattgcctagtaaatcgtgattgtagtgtc
aaaatatgtgactttggacttgcaaggaccatagcacagccagttacgcaggcgccgttg
ggcaagcactgctcctttactgccagagaagttgaagacgaaatgtgtcaagttggagtg
cgcaacctacccaactcagctagattggtggattacaacgacgagctggcccacttccag
cgcaagcgtatgaacgtttctcatagcaggcagctaacgggccacgtagtcacaaggtgg
tacagagcgcccgagttgatattgctccaggataactatactgcagctatcgatgtctgg
tccgtgggatgcattttcgcggaattgctaaatatggttaagggcaatatgtctgatgta
tcacagaggtcgccactgttcccaggtacctcgtgcttccccctatcaccggataataaa
aaccctagtgataaggccaaggaacacgaccagcttaacattatattcaacgttattggc
acgccatgtgaagaggatattgcagcaatcattaaaccggaagtgcgcagatacattagg
atgttccatccaagaaagggtatcgatctttacaagagatttaaaggtacaccaccagcg
gctgtcaacctgctccagcaaatgctaacattcaatccatacaagaggataacagtggcg
gaagcacttaaacacgaatatttccgtgaattctataagccacagcatgtggaaattccc
acggaacaactggtaacaccattcaacgattggatcaacatgtcagagtcacaactaaga
tatgcattcctcagagagatacaaaggtaccacccggagttcaaaataccactcaaaatt
atatacaagccatga

  All links  
No link information was found.   
DBGET integrated database retrieval system