KEGG   Babesia bovis: BBOV_IV006840Help
Entry
BBOV_IV006840     CDS       T01085                                 

Gene name
23.m06508
Definition
histone H2B.1
Orthology
K11252  
histone H2B
Organism
bbo  Babesia bovis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 123 aa AA seqDB search
MSGKVPSSKSQAAKKTAGKSLGIRYRRKKRIESFSLYIYKVLKQVHPETGVSKKSMSIMN
SFINDIFDRMALEATRLIRYNKKSTLSSREIQTAVRLLLPGELSKHAVSEGTKAVTKYTT
SGA
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaaggtgccatcgtccaagagccaggcggccaagaaaaccgccggtaaatca
cttggtatccgctaccgccgtaagaagcgtattgaaagcttctctctctacatctacaag
gtgttgaagcaggtgcaccctgaaactggtgtgtccaagaagtctatgtctatcatgaac
tcattcatcaacgacattttcgaccgcatggctctggaggctacaagacttatcaggtac
aacaagaagagcacactcagctcacgtgaaattcaaactgctgtacgcctacttcttccc
ggtgagctttccaaacacgccgtttctgaaggtaccaaggctgtaaccaagtacaccact
tctggagcttaa

DBGET integrated database retrieval system