KEGG   Babesia bovis: BBOV_IV008020Help
Entry
BBOV_IV008020     CDS       T01085                                 

Gene name
23.m06454
Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
bbo  Babesia bovis
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    BBOV_IV008020 (23.m06454)
  Replication and repair
   03420 Nucleotide excision repair
    BBOV_IV008020 (23.m06454)
Transcription machinery [BR:bbo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     BBOV_IV008020 (23.m06454)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 586 aa AA seqDB search
MEDSFLNHIRLLGDKVWHSLFRRRAPNRAIFRSLGELEQLIILRLVNINQAVPERALRLW
MNPTSFTDFRRALSLLRSYYIVEISDNRAKDGKQQYELNQYFKESTLKDIYDIPLELEQG
FYYLGNVEDRDKIIGNPPSINTLIQHSKERLDFLVLFLVSKEHREKTLRANKILKKIRKL
EKMKGTNTKNPLLFKKVKSLEQQLFTLTKNGKTISSDLLHVLEGYSMIFDEKKKNRIGRG
ESLMSRHALSWLLKGVDTQLIILIVGYLKYIEKGYLFNETNLTDNSEGRNEARTDVNDQE
TIEKLALGTNYLTESLDLLLSLSQARYGDTFRLDNPTLSQQRILRFLIELGLVYADSDGS
KIYVTNLSFLVDVKHANLVEEHQISMSVCGNKGSKMVVQSNFKIYAYIPSALQMNVLNHI
CELQAKTPNLVIGVLTRSSLQTAFKSGITADQLICFFESKGQYDDIQINRNVMNVPENVR
RQLKMWEAERNRLELLNAVVFKRWDNDFIPELFKRVVRWAQTKRYEIYHTAWPSDISSSA
YQKWLENEKYLGCTLESKEEVIEKIKQIRSSLAEEKIRSSSANPYR
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggaagacagcttccttaaccatattagacttctcggagacaaagtatggcactctctt
tttagacgaagagcgccaaatcgtgctatatttcgcagtttaggggagcttgaacagcta
ataattttgcgcctcgttaacataaaccaagctgttcctgagagagccttaaggttatgg
atgaatccaacttcgtttaccgatttcagaagagctttatctttgttgaggtcttattat
atcgttgagatttccgacaaccgtgcgaaggatggaaaacaacaatatgaattgaaccaa
tactttaaagaatcgacgttgaaagatatttatgacatacctctagaattagagcaaggg
ttttactacttaggaaatgttgaggaccgtgataaaatcatcggcaaccctccatcaatc
aacacacttatacagcactcaaaggaacgcttagactttttagtattatttctcgtgtca
aaggagcatcgtgaaaaaacattaagagcgaataaaattttgaagaaaataaggaagcta
gagaaaatgaagggaacaaacacgaaaaatccgttgttattcaaaaaggtcaaatcgtta
gagcaacagctcttcactctaacgaaaaatggaaagaccatttcatccgatcttctacat
gtcttagaaggatatagcatgatatttgatgagaaaaagaagaacaggatcgggagaggt
gaaagtttgatgagtcgccatgccttgagctggctattgaagggagttgatacacaattg
attatattaattgttggatatttaaaatacattgagaaagggtatttatttaatgaaaca
aatttaacagacaattcagaagggagaaatgaagccagaactgatgtaaatgatcaagaa
accatagaaaagttagctttgggaacgaactatttaactgaatctttagatttgctttta
tctctatcgcaggctagatacggtgatacattccgattagataatccgacattgtcccag
caacggatattacgattcctcatcgagttaggcttagtctatgccgattcagatgggagc
aaaatttacgtcactaacttaagtttccttgtggatgttaagcatgcgaatctagttgaa
gaacaccaaatttccatgtcagtttgcggtaataaaggaagcaaaatggttgtgcagagc
aactttaagatttatgcttacataccaagtgcattgcaaatgaatgtattaaatcacatt
tgcgaattgcaagctaagacaccgaatttggtgattggggtgttaacaagatcaagctta
caaacggcattcaagagtgggatcacagcagatcaactaatatgctttttcgaatctaaa
gggcaatatgatgatatacagataaatcgtaatgtgatgaatgttccagaaaacgtgcga
cgtcaattaaaaatgtgggaggccgaacgcaatagacttgaattattaaatgcagtggtg
ttcaaaaggtgggacaatgacttcatcccagagcttttcaaacgtgtagtcagatgggca
caaactaaacgttatgaaatataccatacagcatggccatcggacatatcttcatcagca
tatcaaaaatggctagagaacgagaaatatttaggctgcacgttagaatccaaagaggaa
gtaattgaaaagattaagcagattcggtcgtcgttagcggaagaaaaaatacgttcaagc
tctgcaaatccatatagatag

DBGET integrated database retrieval system