KEGG   Babesia bovis: BBOV_IV009100Help
Entry
BBOV_IV009100     CDS       T01085                                 

Gene name
23.m05770
Definition
protein disulfide isomerase related protein (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
bbo  Babesia bovis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    BBOV_IV009100 (23.m05770)
Enzymes [BR:bbo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BBOV_IV009100 (23.m05770)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 395 aa AA seqDB search
MYSMRVFLLATAFFLSGARGNYGDSSSPVKVLYASSFDNAVANDGVSLVQFLDDTFDSSN
FYRQYETVATCMKDVVNVYAVKDSSVMARFGISSFPSFKVFLGRGPSAKPDVVDYNGKLA
VPDLVTFTMKNVNIHVNKKVRASIQNAGPTASTGKVISLTDAEFERLVVNDRSNQWLILF
YAPWCRHCKAFHPEWARMAQSSGKVKVGSIDATVYTALAARYGVKGFPTIFLFPQGVKSP
TTAIRYKGPRKAEDILQFAKSYYRNMGPPVKVDSVSDLKQRCSRPLCLLFFIPETSMDEH
LSTISLVMEKHSSLPFEFCYTTAGRHLQWERVLGVYSTPAVFALNLSKNVYSVMRKEKLT
FDNVKTFVSEILSGQSSAITLALSFEDNSDSRNEF
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtattccatgcgtgttttcctattggccacggccttcttcctctcaggggctcgtggt
aactatggcgatagctctagtcccgttaaagtattatacgcttcttctttcgacaatgca
gttgctaacgacggagtatctttagtccaatttctcgatgatacttttgacagtagtaat
ttttaccgtcaatatgagactgtcgctacttgcatgaaggatgtggtcaatgtttatgct
gtcaaggattcatccgtcatggctcgatttgggatatcttcctttccttcatttaaggta
ttcctaggtcgtggaccttctgctaagcctgatgtggttgattacaatggcaaattggct
gtgcctgatcttgttaccttcactatgaaaaatgtcaacatacatgttaataagaaggtt
cgggcttctattcaaaatgctggacccactgcttctactggcaaggtgatatctcttact
gatgctgaatttgaacgcctagttgtaaatgatagatcgaaccaatggttgattttgttt
tacgctccttggtgccgtcactgcaaagcttttcaccccgaatgggctcgcatggcccaa
tcttcgggcaaggttaaagttggttccattgatgccactgtctacacagcattggctgcg
cgttacggcgtgaaaggcttccctactatattccttttccctcagggtgtgaagagtcct
actactgcgattagatacaagggacctcgcaaagcggaagacatattgcagtttgcgaag
agttactatcgtaacatgggcccaccggtaaaggttgatagcgtttctgatttgaaacag
agatgcagcaggcctttgtgccttctattcttcatacctgagacttcgatggatgaacat
ttatctactatatctctcgtcatggagaagcattccagtttaccatttgaattttgctat
actacagccggaagacatcttcaatgggaacgagttttgggtgtttactccacccctgca
gtttttgcgttaaacctcagcaagaacgtatactctgttatgaggaaagagaagcttaca
tttgataatgttaaaacgttcgtatcagagattttatcgggccagtctagtgctataaca
ctggcattatcatttgaggacaactcagacagtcgtaacgaattttaa

DBGET integrated database retrieval system