KEGG   Babesia bovis: BBOV_IV011070Help
Entry
BBOV_IV011070     CDS       T01085                                 

Gene name
23.m06338
Definition
phospholipase C gamma 1 (EC:3.1.4.3)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
bbo  Babesia bovis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:bbo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BBOV_IV011070 (23.m06338)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    BBOV_IV011070 (23.m06338)
Enzymes [BR:bbo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     BBOV_IV011070 (23.m06338)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1027 aa AA seqDB search
MSTGLDFNWMRQLTAGNKDAVPSISSSLYNDISHIPIVEAIECVLSGGVLKKWRRGQPIT
PKQNPHEGNSKTKDASNAKEYVMTFSGRPHERYFWVSYICGTYFLRWQSRRKRSNETAFA
LCQLNSIRRGDEVDSFDNKTKNDATEKVEFILSGNVSLRLAAANKRAALMWISGIYHIAI
HASNVYAKAWITNSSKIASLFASGEPGGIPDFKSKTISQELEKDDNSLQNLIDSAKQMSV
DDKEWPESVDDLVYLLQDLKLIRRTDVIEPIVTAVKELLATRESWIHKLIKRLKDVQCKN
VENLVRFAADCACHLKALDVPCEVSRKKIWLFDDYLNVDEAIRLLYNVVKHYSITVDLRH
SNEDDPPSTTERNIIKSGKTNKSLDNDVDGADEKGAQKLDANSSSKKNENNTYEELNQSQ
DLDPLESIPNDQYQKFLENVQRADKFESAEQLIELLTRCTDLPLTVQKPNKQKLGSGLCV
RRVNKSRIPIRAFTIMGFHWSLAQKFNAATIPQDAEEILNLLKYPLNSFWIASSHNTYLT
GNQVGGAAAAGALADALLRGCRCIELDCQDGPNGEPVLCHSWKNCQLTGSITLSEALIAC
KETAFKFSKLPVILSMQMHCTDECKMKTAETCRKILGDALYIPDPANPADFVASIPLGSL
LSKFIIKGKMRTEGTAKNVAAEKKWLSVVALHGYRLTNMTAEDIGRVKRNNVYSLNESKF
AKVAAHQAFLRRLTDISMIRIYPSGTRVASTNFCPLNAWASGIQCVALNYQSCDRSMLIN
YGKFNQSFGYVLKPPELRPITFSNEECLDYFCRGKIKLKVHVLSASQLPPPNEGLEQTSF
ANALDNVLYSIQEGGTELDVNKVATQLGKPPAISKPDPSDRDELQEAIERGLKVDKNDAV
GSLIKVYEKSSNIVNAKVDNCCPFVEIVLVGKGERILKTEIVNFNGFNPVWADTTPPFEF
IVKEPNLAVLLLAVKHHDNVGVQIIGQTALPVNRIRPGIRWAQLLDQRLMEIECCGLLLH
IDITYVD
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaggtcttgattttaactggatgagacagctaacggcagggaacaaagatgcc
gtgccgagcattagctcatctctttataatgatatctcacacattcctatcgtagaagcc
atagaatgtgtgctctcaggaggcgttttgaagaaatggagacgaggtcagccaataaca
ccaaaacaaaaccctcatgagggaaattcaaagacaaaggatgcttcaaacgctaaagaa
tatgttatgacgttttctggccgacctcatgaacgttacttttgggtgtcttatatatgc
ggaacctactttctaagatggcaatcacgtcgtaagcgctcaaatgaaacggctttcgca
ttatgccaattaaatagcatcagaagaggcgatgaagtggatagctttgataacaagacg
aagaatgatgcaactgaaaaggtggaattcattctttcgggcaatgtatcattgcgtcta
gcggctgccaataaacgtgcagctctaatgtggatatctggtatataccacattgcaatc
catgcgtctaatgtttatgcaaaagcttggatcacaaattctagcaaaatcgcttcttta
ttcgcctctggagaacctggtggcatacccgatttcaaatctaaaactatctcacaggaa
ctcgaaaaggatgataattctttgcagaatctgattgatagtgctaaacagatgagtgta
gatgataaagagtggcctgaatctgtagatgatttggtatatttgctccaggatcttaaa
cttatcagacgtactgacgtcatagaacccattgtcacagctgtcaaggaactattggct
acccgtgaatcatggatacacaaactcatcaaaaggttgaaagatgtacaatgtaagaat
gtcgaaaatttggttaggtttgccgctgactgcgcatgtcacctgaaagcattagatgtt
ccctgtgaagtctcacgtaaaaaaatatggttgtttgacgattatttaaatgtggatgaa
gctatccgacttctttacaatgtagtaaaacattattccatcaccgtggatctaaggcat
agcaacgaagatgacccaccttcaaccacagaaagaaatataattaagagtggcaaaaca
aataaatctctagataatgacgttgatggtgctgacgaaaagggtgcccaaaaattggat
gctaattcgtcatcgaaaaaaaatgaaaacaacacatatgaagaattgaatcagtcgcaa
gacttggatcctttagaatctattcctaatgatcaatatcaaaagtttctcgaaaatgta
caacgcgcagataaatttgaaagtgcagaacaactaatagagctcttgacacgttgtact
gatctccctttaacagttcaaaaaccgaataagcagaaactaggttccggtctctgtgta
agaagggtaaacaaatcacgaattcccattagggcgttcacaatcatgggattccattgg
tcccttgcgcaaaagttcaatgcggcaaccataccacaagatgcagaagaaatccttaat
ttgctcaaatatccactaaattccttttggatagcgagctctcacaatacgtatcttacg
ggaaatcaagtgggaggggcagcggcggcaggagcattagctgacgcgcttttgagagga
tgtagatgcattgaactagactgccaagacggtccaaatggggagcctgtgctttgtcat
tcatggaaaaactgtcaacttacaggttcaattacgctaagtgaggcattgattgcttgt
aaagagaccgcgttcaaattttcaaagctacctgtgatattgtccatgcaaatgcattgt
acggacgaatgtaagatgaaaacggctgagacatgccggaaaatattaggtgacgcttta
tacatacccgatccagcaaatcctgctgactttgttgcatccataccattagggtctttg
ttgtccaaatttatcatcaaaggtaaaatgcgcacagaaggtacagcaaagaacgttgca
gcagagaaaaagtggttatcagttgttgcgttacatggatacagattgaccaatatgaca
gcggaggacataggacgtgtaaaaagaaataatgtatacagccttaacgaaagtaaattc
gcaaaggtagctgcccatcaagcattcttacgtagactcaccgatatctcaatgattagg
atatatccttctggtacaagagttgccagcactaatttttgccctctaaatgcatgggct
tcaggcatacaatgtgttgcacttaattatcaatcgtgtgacaggtcgatgctgattaat
tatggaaagttcaatcaaagctttggatacgtgctgaaacctcccgaactgaggccaata
actttcagcaatgaggagtgcttagactatttctgccgtgggaaaataaaacttaaagtt
cacgtcctctcggcatcgcaactccctcctccaaatgagggacttgagcaaactagcttt
gcaaatgcgttggataatgtattatactcgatacaagagggtggcactgaattagatgtg
aataaagtggcaacacaattggggaaacctcccgctattagtaagccagatccatctgac
cgtgatgaactacaagaagctattgaaaggggactcaaagtggataaaaatgacgccgta
gggtcgttaatcaaagtctacgagaagtcttcaaacatagtcaacgcaaaggtggataat
tgttgtccctttgttgaaattgttctggtcggaaagggtgaacgtatattgaaaactgaa
attgtcaacttcaatggttttaatcctgtatgggccgatactaccccgccgttcgagttt
atcgtcaaagagccgaatcttgctgtattgctgttagcggtaaaacaccatgacaacgtt
ggcgtccagattataggccaaacagctctaccggttaatcgtatccgtcctggcattcga
tgggcacagcttttggatcagcggctaatggaaatcgagtgttgtggtttactcctacat
atagacataacttatgtggattaa

DBGET integrated database retrieval system