KEGG   Babesia bovis: BBOV_IV011070Help
Entry
BBOV_IV011070     CDS       T01085                                 

Gene name
23.m06338
Definition
phospholipase C gamma 1 (EC:3.1.4.3)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
bbo  Babesia bovis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:bbo00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:bbo04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1027 aa AA seqDB search
MSTGLDFNWMRQLTAGNKDAVPSISSSLYNDISHIPIVEAIECVLSGGVLKKWRRGQPIT
PKQNPHEGNSKTKDASNAKEYVMTFSGRPHERYFWVSYICGTYFLRWQSRRKRSNETAFA
LCQLNSIRRGDEVDSFDNKTKNDATEKVEFILSGNVSLRLAAANKRAALMWISGIYHIAI
HASNVYAKAWITNSSKIASLFASGEPGGIPDFKSKTISQELEKDDNSLQNLIDSAKQMSV
DDKEWPESVDDLVYLLQDLKLIRRTDVIEPIVTAVKELLATRESWIHKLIKRLKDVQCKN
VENLVRFAADCACHLKALDVPCEVSRKKIWLFDDYLNVDEAIRLLYNVVKHYSITVDLRH
SNEDDPPSTTERNIIKSGKTNKSLDNDVDGADEKGAQKLDANSSSKKNENNTYEELNQSQ
DLDPLESIPNDQYQKFLENVQRADKFESAEQLIELLTRCTDLPLTVQKPNKQKLGSGLCV
RRVNKSRIPIRAFTIMGFHWSLAQKFNAATIPQDAEEILNLLKYPLNSFWIASSHNTYLT
GNQVGGAAAAGALADALLRGCRCIELDCQDGPNGEPVLCHSWKNCQLTGSITLSEALIAC
KETAFKFSKLPVILSMQMHCTDECKMKTAETCRKILGDALYIPDPANPADFVASIPLGSL
LSKFIIKGKMRTEGTAKNVAAEKKWLSVVALHGYRLTNMTAEDIGRVKRNNVYSLNESKF
AKVAAHQAFLRRLTDISMIRIYPSGTRVASTNFCPLNAWASGIQCVALNYQSCDRSMLIN
YGKFNQSFGYVLKPPELRPITFSNEECLDYFCRGKIKLKVHVLSASQLPPPNEGLEQTSF
ANALDNVLYSIQEGGTELDVNKVATQLGKPPAISKPDPSDRDELQEAIERGLKVDKNDAV
GSLIKVYEKSSNIVNAKVDNCCPFVEIVLVGKGERILKTEIVNFNGFNPVWADTTPPFEF
IVKEPNLAVLLLAVKHHDNVGVQIIGQTALPVNRIRPGIRWAQLLDQRLMEIECCGLLLH
IDITYVD
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaggtcttgattttaactggatgagacagctaacggcagggaacaaagatgcc
gtgccgagcattagctcatctctttataatgatatctcacacattcctatcgtagaagcc
atagaatgtgtgctctcaggaggcgttttgaagaaatggagacgaggtcagccaataaca
ccaaaacaaaaccctcatgagggaaattcaaagacaaaggatgcttcaaacgctaaagaa
tatgttatgacgttttctggccgacctcatgaacgttacttttgggtgtcttatatatgc
ggaacctactttctaagatggcaatcacgtcgtaagcgctcaaatgaaacggctttcgca
ttatgccaattaaatagcatcagaagaggcgatgaagtggatagctttgataacaagacg
aagaatgatgcaactgaaaaggtggaattcattctttcgggcaatgtatcattgcgtcta
gcggctgccaataaacgtgcagctctaatgtggatatctggtatataccacattgcaatc
catgcgtctaatgtttatgcaaaagcttggatcacaaattctagcaaaatcgcttcttta
ttcgcctctggagaacctggtggcatacccgatttcaaatctaaaactatctcacaggaa
ctcgaaaaggatgataattctttgcagaatctgattgatagtgctaaacagatgagtgta
gatgataaagagtggcctgaatctgtagatgatttggtatatttgctccaggatcttaaa
cttatcagacgtactgacgtcatagaacccattgtcacagctgtcaaggaactattggct
acccgtgaatcatggatacacaaactcatcaaaaggttgaaagatgtacaatgtaagaat
gtcgaaaatttggttaggtttgccgctgactgcgcatgtcacctgaaagcattagatgtt
ccctgtgaagtctcacgtaaaaaaatatggttgtttgacgattatttaaatgtggatgaa
gctatccgacttctttacaatgtagtaaaacattattccatcaccgtggatctaaggcat
agcaacgaagatgacccaccttcaaccacagaaagaaatataattaagagtggcaaaaca
aataaatctctagataatgacgttgatggtgctgacgaaaagggtgcccaaaaattggat
gctaattcgtcatcgaaaaaaaatgaaaacaacacatatgaagaattgaatcagtcgcaa
gacttggatcctttagaatctattcctaatgatcaatatcaaaagtttctcgaaaatgta
caacgcgcagataaatttgaaagtgcagaacaactaatagagctcttgacacgttgtact
gatctccctttaacagttcaaaaaccgaataagcagaaactaggttccggtctctgtgta
agaagggtaaacaaatcacgaattcccattagggcgttcacaatcatgggattccattgg
tcccttgcgcaaaagttcaatgcggcaaccataccacaagatgcagaagaaatccttaat
ttgctcaaatatccactaaattccttttggatagcgagctctcacaatacgtatcttacg
ggaaatcaagtgggaggggcagcggcggcaggagcattagctgacgcgcttttgagagga
tgtagatgcattgaactagactgccaagacggtccaaatggggagcctgtgctttgtcat
tcatggaaaaactgtcaacttacaggttcaattacgctaagtgaggcattgattgcttgt
aaagagaccgcgttcaaattttcaaagctacctgtgatattgtccatgcaaatgcattgt
acggacgaatgtaagatgaaaacggctgagacatgccggaaaatattaggtgacgcttta
tacatacccgatccagcaaatcctgctgactttgttgcatccataccattagggtctttg
ttgtccaaatttatcatcaaaggtaaaatgcgcacagaaggtacagcaaagaacgttgca
gcagagaaaaagtggttatcagttgttgcgttacatggatacagattgaccaatatgaca
gcggaggacataggacgtgtaaaaagaaataatgtatacagccttaacgaaagtaaattc
gcaaaggtagctgcccatcaagcattcttacgtagactcaccgatatctcaatgattagg
atatatccttctggtacaagagttgccagcactaatttttgccctctaaatgcatgggct
tcaggcatacaatgtgttgcacttaattatcaatcgtgtgacaggtcgatgctgattaat
tatggaaagttcaatcaaagctttggatacgtgctgaaacctcccgaactgaggccaata
actttcagcaatgaggagtgcttagactatttctgccgtgggaaaataaaacttaaagtt
cacgtcctctcggcatcgcaactccctcctccaaatgagggacttgagcaaactagcttt
gcaaatgcgttggataatgtattatactcgatacaagagggtggcactgaattagatgtg
aataaagtggcaacacaattggggaaacctcccgctattagtaagccagatccatctgac
cgtgatgaactacaagaagctattgaaaggggactcaaagtggataaaaatgacgccgta
gggtcgttaatcaaagtctacgagaagtcttcaaacatagtcaacgcaaaggtggataat
tgttgtccctttgttgaaattgttctggtcggaaagggtgaacgtatattgaaaactgaa
attgtcaacttcaatggttttaatcctgtatgggccgatactaccccgccgttcgagttt
atcgtcaaagagccgaatcttgctgtattgctgttagcggtaaaacaccatgacaacgtt
ggcgtccagattataggccaaacagctctaccggttaatcgtatccgtcctggcattcga
tgggcacagcttttggatcagcggctaatggaaatcgagtgttgtggtttactcctacat
atagacataacttatgtggattaa

DBGET integrated database retrieval system