KEGG   Bifidobacterium bifidum PRL2010: BBPR_0112Help
Entry
BBPR_0112         CDS       T01340                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBPR_0112 (pldB)
Enzymes [BR:bbp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BBPR_0112 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
131976..133031
Genome map
AA seq 351 aa AA seqDB search
MQVKLIDENRYADEMREMVLPALATCRSEGWMAPADDDGLPPLQRAGKLHYVCYDAAKFD
RLGEDGAAATFRGAVVISHGFTEFAAKYAEMVWYFLLAGYSVCVFEHRGHGYSARDVDNS
SLVWIDDWRRYVADLAKFAETVGKDYADGRPLNLYCHSMGGGIGASVLETHPTLFDKAVL
SCPMIAPVTGMPNWLASVLAAAMCRLGLGRHMVFGQSEFTPELDMADYEGASEARVRWFQ
QQRIDDPHQRTFAATFAWVRQALRLSRAVQRPEACDNVETPVLLFQAGRDVWVLNEPQNR
FAQEVNSDGGNVRVIRIENSLHEIFSMPNAVLGPYLERILGFFSSSEMPTF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgaagcttatcgacgagaaccgctatgcagacgagatgcgcgagatggtgctg
cccgcgcttgccacatgccggtccgaaggctggatggcgccggcggacgacgacggtctg
ccgccgctgcagcgtgcgggcaaactgcattacgtgtgttacgacgcggcgaaattcgac
cggttgggcgaggacggcgccgccgccacattccgcggtgccgtggtgatctcccacggg
ttcacggagttcgccgcgaaatatgcggagatggtgtggtacttcctgctcgcagggtac
tcggtgtgcgtgttcgagcaccgcggacatgggtattccgcgcgtgacgtcgacaattcg
tccctggtgtggattgatgattggcggcggtatgtggccgatctggcgaaattcgcggag
acggtgggcaaggattacgcggatggccgtccgctgaacctgtactgccattcgatgggc
ggcggcatcggggcgagtgtgctggagacgcatccgacgctgttcgacaaggccgtgctg
tcgtgcccgatgatcgcgccggtgaccggtatgccgaactggctggcgtcggtgcttgcc
gccgcgatgtgccggctcgggctgggacggcacatggtgttcgggcagagtgagttcacg
ccggagctggatatggccgattacgagggcgcgagcgaggcccgcgtgcgctggttccaa
cagcagcgcatcgacgacccgcatcagcggacgttcgcggcgacattcgcgtgggtgcgg
caggcgctgcgactgtcgcgtgccgtgcagcggccggaggcgtgcgacaatgtcgagacg
ccggtgctgctgttccaggccgggcgcgacgtgtgggtgctcaacgagccgcagaaccgg
ttcgcgcaggaggtcaactccgatggagggaatgtgcgcgtgatacgcatcgagaactcg
ctgcatgagattttcagcatgcccaatgccgttcttgggccgtatctggagcggattctg
ggcttcttcagttcatctgagatgccgacgttctga

DBGET integrated database retrieval system