KEGG   Bifidobacterium bifidum PRL2010: BBPR_0112Help
Entry
BBPR_0112         CDS       T01340                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bbp00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
131976..133031
Genome map
AA seq 351 aa AA seqDB search
MQVKLIDENRYADEMREMVLPALATCRSEGWMAPADDDGLPPLQRAGKLHYVCYDAAKFD
RLGEDGAAATFRGAVVISHGFTEFAAKYAEMVWYFLLAGYSVCVFEHRGHGYSARDVDNS
SLVWIDDWRRYVADLAKFAETVGKDYADGRPLNLYCHSMGGGIGASVLETHPTLFDKAVL
SCPMIAPVTGMPNWLASVLAAAMCRLGLGRHMVFGQSEFTPELDMADYEGASEARVRWFQ
QQRIDDPHQRTFAATFAWVRQALRLSRAVQRPEACDNVETPVLLFQAGRDVWVLNEPQNR
FAQEVNSDGGNVRVIRIENSLHEIFSMPNAVLGPYLERILGFFSSSEMPTF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgaagcttatcgacgagaaccgctatgcagacgagatgcgcgagatggtgctg
cccgcgcttgccacatgccggtccgaaggctggatggcgccggcggacgacgacggtctg
ccgccgctgcagcgtgcgggcaaactgcattacgtgtgttacgacgcggcgaaattcgac
cggttgggcgaggacggcgccgccgccacattccgcggtgccgtggtgatctcccacggg
ttcacggagttcgccgcgaaatatgcggagatggtgtggtacttcctgctcgcagggtac
tcggtgtgcgtgttcgagcaccgcggacatgggtattccgcgcgtgacgtcgacaattcg
tccctggtgtggattgatgattggcggcggtatgtggccgatctggcgaaattcgcggag
acggtgggcaaggattacgcggatggccgtccgctgaacctgtactgccattcgatgggc
ggcggcatcggggcgagtgtgctggagacgcatccgacgctgttcgacaaggccgtgctg
tcgtgcccgatgatcgcgccggtgaccggtatgccgaactggctggcgtcggtgcttgcc
gccgcgatgtgccggctcgggctgggacggcacatggtgttcgggcagagtgagttcacg
ccggagctggatatggccgattacgagggcgcgagcgaggcccgcgtgcgctggttccaa
cagcagcgcatcgacgacccgcatcagcggacgttcgcggcgacattcgcgtgggtgcgg
caggcgctgcgactgtcgcgtgccgtgcagcggccggaggcgtgcgacaatgtcgagacg
ccggtgctgctgttccaggccgggcgcgacgtgtgggtgctcaacgagccgcagaaccgg
ttcgcgcaggaggtcaactccgatggagggaatgtgcgcgtgatacgcatcgagaactcg
ctgcatgagattttcagcatgcccaatgccgttcttgggccgtatctggagcggattctg
ggcttcttcagttcatctgagatgccgacgttctga

DBGET integrated database retrieval system