KEGG   Bifidobacterium bifidum PRL2010: BBPR_0164Help
Entry
BBPR_0164         CDS       T01340                                 

Definition
type II restriction-modification system restriction subunit (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bbp00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
194707..196887
Genome map
AA seq 726 aa AA seqDB search
MRARRDFAWPKLLTADGRGIAFGGDYNPDQWPEDVWDDDIRLMTQAGVNTVALAIFSWDR
LQPTEDHWDFGWLDRIIDKLGKAGIAVDLASATATAPLWLYENHPEVLPRDKYGHPVNAG
SRQSWSPTSPVFKEYALTLCRKLAERYGANPYVTAWHMGNEYGWNNRDDYSDNALEAFRA
WCRRKYGTIDALNQAWGTTFWGQEMTGFGEVLIPRFMGADSMVNPGQKLDFERFGNDMLL
DFYKAERDAIAEICPDRPFTTNFMISTDQCCMDYAAWAEEVDFVSNDHYFHEGESHLDEL
ACSDALVDSLALGKPWYVMEHSTSAVQWKPLNTRKCKGETVRDSLAHVAMGADAINFFQW
RASAFGAEAFHSAMVPHAGEDTKLFRQVCELGATLRALADAGVQGSGLAASDTAILFSAE
SEWATRSETLPSMKLSHWHDVRDWYRAFLNAGARADIVPLAYDWSSYKTIVLPTVLILSD
ADTRRLAGFVQAGGRVVVDYATGLLDERFHTWLGGYPGAGDGLLRSMLGVRGEEFNILGA
GAEGEPNEIRLTGTRDSSTMDGAVTRLWQNDVTVAGPHVQVLATYAGEEADEWELDGTAA
LTRNAYGAGEAYFLGCDLGVSDLTRFVSGWLAVQPQSSRQPQVNSQSQSSRQPQVVGATP
DVLHTVRQSDDAIFDFYLTRGRSDVELRGIAGEPIVLFRAERGSDGGAYTVHRNGVLVVK
RPNPSL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcgcgacgtgactttgcatggccgaaactgctgaccgcggacggacgcggcatc
gccttcggcggcgactacaatcccgaccaatggccggaggacgtctgggacgacgacatc
cgcctgatgacccaggccggtgtcaacaccgtggcccttgccatcttcagctgggaccgc
ctccaacccaccgaagaccattgggattttggctggctcgatcgcatcatcgacaagctc
ggcaaggctggcatcgcggttgatttggcatccgcgacggcgaccgcacccctgtggctc
tacgaaaaccatcccgaagtccttccgcgagacaagtacggtcatccggtcaacgccggc
tcccgccagtcctggagcccgaccagcccggtgttcaaggaatacgcgctaaccctatgc
cgcaaactcgccgaacgctacggcgccaacccatatgtgacggcatggcatatgggaaac
gagtatgggtggaacaatcgcgacgactactccgacaatgcgctcgaagccttccgcgca
tggtgccgccgcaagtacggcaccatcgacgcacttaaccaggcgtggggcaccacgttc
tggggacaggagatgaccggtttcggcgaagtgctcatcccgcggttcatgggtgccgat
tccatggtcaaccccggccagaagcttgattttgaacggttcggcaatgacatgctgctc
gacttctacaaagccgaacgtgacgcgatcgccgaaatctgccccgacagacccttcacc
acgaacttcatgatctccaccgaccagtgctgtatggactacgccgcgtgggcggaggaa
gtggacttcgtatcgaacgaccactacttccacgaaggcgaatcccatctcgacgagctg
gcctgctccgatgcgctcgtggattcgctggcgctcggcaaaccgtggtacgtcatggaa
cattccacctcagcggtgcagtggaaaccgctgaacacccgcaaatgtaaaggggagacg
gtgcgcgactccctggcccacgtggccatgggcgcagacgccatcaacttcttccagtgg
cgcgcatccgcgttcggcgccgaagcgttccattccgctatggtcccgcacgccggcgag
gacacgaaactgttccgtcaggtgtgcgaattgggcgcgacgttgcgggcgctcgccgac
gccggtgttcaaggcagcggattggcggcatcggacacggcgatcctcttcagcgccgaa
tcggagtgggccacccgatccgagacattgccgagcatgaaactcagccattggcatgat
gtgcgtgactggtaccgtgcgttcctgaacgctggtgcacgcgccgacatcgtgccgctc
gcctacgactggagttcctataagaccatcgtgctgccgaccgtactgatactgagcgac
gccgatacgcggcggttggccggtttcgtacaggccggaggccgtgtggtggtcgattac
gcgaccggtctgctcgacgagcgcttccacacgtggctcggcgggtatcccggtgcgggc
gatgggctgttgcgctcgatgctgggcgttcgtggtgaggaattcaacattctcggtgct
ggggcggaaggcgagccgaacgagattcggctgacgggcaccagggattcatccacgatg
gacggtgccgtgacccgcctgtggcagaacgacgtgaccgtcgccggaccgcatgtgcag
gtgcttgccacatatgccggcgaagaagcggatgagtgggagcttgatggcacggccgcg
ctcacccgcaacgcatacggcgcgggggaggcgtatttcctcggctgtgatctgggcgtg
agcgacctgacgcgattcgtgagcggctggcttgccgtgcagccgcaatcctcccgtcag
ccgcaggtcaacagtcagtcgcaatccagccgtcagccgcaagtcgtcggcgcgacccct
gatgttctgcacaccgtgcgtcaatccgacgacgccatattcgacttctacctgacacgt
ggcagatcggatgtcgaactgcgtggcatcgccggggagccgatcgtcctgttccgggcg
gaacggggcagtgacggcggtgcgtatacggtgcatcgcaatggcgttctcgtggtgaaa
cgcccgaacccgtcgctgtag

DBGET integrated database retrieval system