KEGG   Bifidobacterium bifidum PRL2010: BBPR_0249Help
Entry
BBPR_0249         CDS       T01340                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase DapE (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BBPR_0249 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BBPR_0249 (dapE)
Enzymes [BR:bbp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BBPR_0249 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
303341..304591
Genome map
AA seq 416 aa AA seqDB search
MTTTTTMAAAGADPRSAIAPITCDTTGTREKALASLLEQIMDSYSVSDDEKPLADAVEAF
LRSKPHLTVHRHSDTVVASTSLGRPRRVVLAGHLDTVPVIDNFPPRWLAPGDPLIREDVA
AAHPGERVMWGRGATDMKASDAVFLYLAATLVDPQYDLTYVFYDHEEVAAEKNGLRKVAE
AHPDWIAGDFALIGEPTDCGIEGGCNGTMRFDVVTHGVAAHSARAWMGENAIHKAADVLN
RLNSYEPRTITVDGLDYREGLNATLISGGKGTNVIPDECRVHVNYRFAPDKTLPQAKALM
MGADAGAELGNGEHVATGGVFEGFGIEMKDESPSARPGMDAPMAVSLAKLVRERTGREPL
AKLGWTDVARFSLLGVPAVNLGAGSPLLAHKHDEQIAESELATMAGILEDWLTGRA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgactacgacaacgacgatggcagcggccggcgctgacccgcgctcggcgatcgcgccg
atcacctgcgacacgaccggcacgcgcgagaaggcgctcgcctcactgctcgaacagatc
atggactcgtattccgtcagcgatgacgagaagccgctggccgacgccgtagaggcgttc
ctgcggtcgaagccgcacctgacggtgcacaggcacagcgacacggtggtcgcgtccacg
tcgctcggcaggcctcggcgcgtggtgctcgccgggcaccttgacacggttccggtgatc
gacaactttccgccgcgctggctggcgcccggcgacccgctgatccgggaggacgtcgcc
gcggcgcaccccggtgaacgggtgatgtggggccgcggcgcgaccgacatgaaggcatcc
gacgcggtgttcctgtacctcgccgccacgctggtcgacccgcaatatgacctgacgtac
gtgttctacgaccatgaggaggttgcggccgagaagaacggtctgcggaaggtggccgag
gcgcatcccgattggatcgccggcgatttcgcgctcatcggcgagccgaccgactgcggc
atcgagggcggctgcaacggcaccatgcgattcgacgtggtcacgcacggggtcgcggcg
cattcggccagggcatggatgggggagaatgccattcacaaggccgccgatgtcctgaac
cgcctgaactcctacgagccgcgcaccatcacggtggatgggctggattatcgcgagggg
ctgaacgcgacgctgatttccggcggcaaggggacgaatgtcatccccgacgaatgccgt
gtccatgtgaactaccggttcgcgcccgacaagacgctgccgcaggcgaaggcactgatg
atgggcgcggatgccggcgcggagctcggcaatggcgagcatgtcgccaccggtggcgtg
ttcgagggcttcggcatcgagatgaaggacgagtcgccgtccgcccggccgggcatggac
gcgccgatggcggtgtcgttggcgaagctggtgcgtgagcgtacgggacgggaaccgctg
gcgaagctcgggtggaccgatgtcgcgcggttctcgctgctgggtgtgcccgcggtgaac
ctgggcgcggggagcccgctgcttgcgcacaagcatgacgagcagatcgccgaaagcgag
ttggcgaccatggccggcatcctggaggactggctcaccggccgcgcgtga

DBGET integrated database retrieval system