KEGG   Bifidobacterium bifidum PRL2010: BBPR_0482Help
Entry
BBPR_0482         CDS       T01340                                 

Gene name
lacZ
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bbp00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bbp00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bbp00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
610412..616219
Genome map
AA seq 1935 aa AA seqDB search
MAVRRLGGRIVAFAATVALSIPLGLLTNSAWAVEDATRSDSTTQMSSTPEVVYSSAVDSK
QNRTSDFDANWKFMLSDSVQAQDPAFDDSAWQQVDLPHDYSITQKYSQSNEAESAYLPGG
TGWYRKSFTIDRDLAGKRIAINFDGVYMNATVWFNGVKLGTHPYGYSPFSFDLTGNAKFG
EENTIVVKVENRLPSSRWYSGSGIYRDVTLTVTDGVHVGNNGVAIKTPSLATQNGGNVTM
NLTTKVANDTKAAANITLKQTVFPKGGKTDAAIGTVTTASKSIAAGASADVTSTITAASP
KLWSIKNPNLYTVRTEVLNGGKVLDTYDTEYGFRWTGFDATSGFSLNGEKVKLKGVSMHH
DQGSLGAVANRRAIERQVEILQKMGVNSIRTTHNPAAKALIDVCNEKGVLVVEEVFDMWN
RSKNGNTEDYGKWFGQAIAGDNAVLGGDKDETWAKFDLTSTINRDRNAPSVIMWSLGNEM
MEGISGSVSGFPATSAKLVAWTKAADSTRPMTYGDNKIKANWNESNTMGDNLTANGGVVG
TNYSNGANYDKIRTDHPSWAIYGSETASAINSRGIYNRTTGGAQSSDKQLTSYDNSAVGW
GAVASSAWYDVVQRDFVAGTYVWTGFDYLGEPTPWNGTVSGAVGSWPSPKNSYFGIVDTA
GFPKDTYYFYQSQWNDDVHTLHILPAWNENVVAKGSGNNVPVVVYTDAAKVKLYFTPKGS
TEKRLIGEKSFTKKTTAAGYTYQVYEGTDKDSTAHKNMYLTWNVPWAEGTISAEAYDENN
RLIPEGSTEGNASVTTTGKAAKLKADADRKTITADGKDLSYIEVDVTDANGHIVPDAANR
VTFDVKGAGKLVGVDNGSSPDHDSYQADNRKAFSGKVLAIVQSTKEAGEITVTAKADGLQ
SSTVKIATTAVPGTSTEKTVRSFYYSRNYYVKTGNKPILPSDVEVRYSDGTSDRQNVTWD
AVSDDQIAKAGSFSVAGTVAGQKISVRVTMIDEIGALLNYSASTPVGTPAVLPDSRPAVL
PDGTVTSANFAVHWTKPADTVYNTAGTVKVPGTATVFGKEFKVTATIRVQRSQVTIGSSV
SGNALSLTQNIPDDKQSDTLDAIKDGSTTVDANTGGGANPSAWTNWAYSKAGHNTAEITF
EYATEQQLGQIVMYFFRDSNAVRFPDAGKTKIQISADGKNWTDLAATETIAAQESSDRVK
PYTYDFAPVGATFVKVTVTNADTTTPSGVVCAGLTEIELKTATSKFVTNTSAALSSLTVN
GTKVSDSVLAAGSYNTPAIIADVKAEGEGNASVTVLPAHDNVIRVITESEDHVTRKTFTI
NLGTEQEFPADSDERDYPAADMTVTAGSEQTSGTATEGPKKFAVDGNTSTYWHSNWTPTT
VNDLWIAFELQKPTKLDALRYLPRPAGSKNGSVTEYKVQVSDDGTNWTDAGSGTWTTDYG
WKLAEFNQPVTTKHVRLKAVHTYADSGNDKFMSASEIRLRKAVDTTDISGATVTVPAKLT
VDRVDADHPATFATKDVTVTLGDATLRYGVDYLLDYAGNTAVGKATVTVRGIDKYSGTVA
KTFTIELKDAPAPKPTLTSVSVKTKPSKLTYVVDDKFDPAGLVLQLNYDDDSTGTVTWNT
QTAGDFTFKPALDAKLKVTDKTVTVTYQGKSAVIDITVSQPAPTVSKTDLDKAIKAIEAK
NPDSSKYTADSWKTFADAMAHAKAVIADDSATQQDVDNALKALTDAYAGLTEKTPEPAPV
SKSELDKKIKAIEAEKLDGSKYTADSWKAFETALAHAKAVIASDSATQQDVDAALGALTS
ARDGLTEKGEVKPDPKPEPGTVDKAALDKAVKKVEAEKLDGSKYTADSWKAFETALAHAK
AVIGNANSTQFDIDNALSMLNDARAALKEKPGRIIAIIDGSALSKTGASVAIIASVAAAM
LAVGAGVMALRRKRS
NT seq 5808 nt NT seq  +upstreamnt  +downstreamnt
atggcagttcgcagacttggtggccgcatcgtggctttcgccgccacagtggccttgtca
ataccgttagggttgttaacaaattcagcgtgggcggtcgaggacgccacccgatccgac
tccaccacgcagatgagctccacgccggaggtggtctactccagcgccgtggattccaag
cagaatcgcacctcggatttcgacgccaactggaagttcatgctgtccgattccgtgcag
gcgcaggatccggcgttcgacgattcggcctggcagcaggtcgacctgccgcatgactac
agcatcacgcagaagtattcgcagagcaacgaggccgaaagcgcataccttcccggcggc
accggctggtaccgcaagtccttcaccatcgaccgggacctcgccggcaagcgcatcgcc
atcaacttcgacggcgtgtacatgaacgccaccgtctggttcaacggcgtcaagctcggc
acccatccgtacggctactcgccgttctccttcgacctgaccggcaacgccaagttcggc
gaggagaacaccatcgtcgtcaaggtcgagaacaggctgccgtccagccgctggtactcc
ggctccggcatctaccgcgacgtcaccctcaccgtcaccgacggcgtgcacgtcggcaat
aacggcgtggccatcaagaccccgagcctcgccacccaaaacggcggcaacgtgacgatg
aacctcaccaccaaggtcgccaacgacaccaaggccgcggcaaacatcaccctcaagcag
accgtgttccccaagggaggcaagaccgacgccgccatcggcaccgtcaccaccgcatcc
aagtccatcgcggccggtgccagcgcggacgtgacctccacgatcaccgccgcctcgccc
aagctgtggagcatcaagaacccgaacctgtacaccgtgcgcaccgaagtgctcaacggc
ggcaaggtgctcgacacttacgacaccgaatatggcttccgctggaccggcttcgatgcg
accagcggtttctcgctcaacggcgagaaagtcaagctcaagggcgtctcaatgcatcat
gaccagggatcgcttggtgcggtcgccaaccgccgcgccatcgagcgccaggtcgagatt
ctccagaagatgggcgtcaactcgatccgcaccacgcacaaccccgcagccaaggcgctg
attgacgtctgcaacgagaagggcgtcctcgtggtcgaagaggtcttcgacatgtggaac
cggtcgaagaacggcaacaccgaggattacggcaagtggttcggccaggccatcgccggt
gacaacgccgtcctgggtggcgacaaggacgagacctgggccaagttcgacctgaccagc
accatcaaccgtgacaggaacgccccgtccgtcatcatgtggtcgctcggcaacgagatg
atggaaggcatcagcggcagcgtctcgggcttcccggctacctccgccaagctggtcgca
tggacgaaggccgcggacagcacccgcccgatgacctacggcgacaacaagatcaaggcc
aactggaacgagtcgaacacgatgggcgacaacctgaccgccaacggcggcgtggtcggc
accaactactccaacggcgcgaactacgacaagatccgcacggaccacccctcatgggcc
atctacggttccgagacggcgtccgccatcaacagccgaggcatctacaaccgcaccacc
ggcggcgcccagtcaagcgacaagcagctgaccagctatgacaattccgcagtcggctgg
ggcgccgtcgccagctccgcctggtacgacgtggtccagcgcgatttcgtcgccggcaca
tacgtgtggaccggcttcgactacctcggcgaacccaccccgtggaacggcaccgtctcc
ggcgccgtgggctcctggccgtcgccgaagaactcgtacttcggcatcgtcgacaccgca
ggattcccgaaggacacctattacttctatcagagccagtggaacgacgacgtgcacacg
ctgcacatcctccccgcatggaacgagaacgtcgtcgccaagggctccggcaacaacgtg
ccggtcgtcgtctacaccgacgcggccaaggtcaagctgtacttcacaccgaagggcagc
accgaaaagcgactgatcggagagaagtccttcaccaagaagaccaccgcggccggatac
acctatcaggtctatgagggcaccgacaaggactccaccgcccacaagaacatgtacctg
acctggaacgtgccgtgggccgagggcaccatctccgccgaagcatacgacgagaacaac
aggctgatccccgaggggtccaccgagggcaacgcgtcggtgaccaccaccggcaaggcc
gcgaagcttaaagccgatgccgaccgcaagacgatcaccgcggacggcaaggacctgtcg
tacatcgaggtcgacgtgaccgacgccaacggccatatcgtccccgatgccgccaaccgc
gtcaccttcgacgtcaagggcgccggcaaactggtcggcgtcgacaacggcagctcgccg
gatcacgactcctatcaggccgacaaccgcaaggcgttcagcggcaaggtgctcgccatc
gttcagtccaccaaggaggcgggcgagatcaccgtcaccgccaaggccgacggtctgcaa
tcatccacagtgaagatcgccaccaccgccgtccccggcaccagcaccgagaagacggtc
cgcagcttctactactcgcgcaactactacgtcaagaccggcaacaagccgattctgccg
agtgatgtcgaggtgcgctactccgacggcacgtcggaccgtcagaacgtcacatgggac
gcagtcagcgacgaccagatcgccaaggccggttcgttcagcgtggccggcacggtcgcc
gggcagaagatctccgtgcgcgtgacgatgatcgacgagatcggtgcgctgctcaactat
tcggccagcacaccggtcggcacgcccgccgtgctgcctgactcgcgtccggccgtgctg
cccgacggcaccgtgaccagcgcgaacttcgccgtccactggaccaagcccgccgacacc
gtgtacaacacggccggcaccgtcaaggtccccggcaccgccaccgtcttcggcaaggag
ttcaaggtcaccgcgacgatccgcgtgcagcggtcgcaggtcaccatcggcagcagcgtc
tccggcaatgcgctgagcctgactcagaacatccccgacgacaagcagtccgacacgctg
gacgccatcaaggacggctccacgaccgtcgacgccaataccggcggcggcgcgaacccg
tcagcatggaccaactgggcgtactcgaaggccggccacaacaccgccgagatcaccttc
gagtacgcgaccgagcagcagctcggccagattgtcatgtacttcttccgcgacagcaac
gcggtgaggttccccgacgccggcaagacgaagatccagatctccgcggacggcaagaac
tggacggatctcgctgccacggagaccatcgcggcccaggagtcgtccgaccgagtcaag
ccgtacacctatgacttcgctccggtgggagccacgttcgtcaaggtcacggtcaccaac
gccgacaccacaacccccagcggcgtggtctgcgccggcctgaccgagatcgagctgaag
accgcgaccagcaagttcgtcacgaacacgtccgccgcgctctcgtcgctgacggtgaac
ggcacgaaggtctccgactccgtgctcgccgccggctcctacaacacgcccgcgatcatc
gcggacgtcaaagccgagggcgaaggcaacgccagcgtcactgtgctgcccgcgcacgac
aacgtgatccgcgtgatcaccgagtctgaggaccacgtcacgcgcaagaccttcaccatc
aacctgggcacggagcaggaattccccgcagactccgatgagcgcgactacccggccgcc
gacatgacggtcaccgcgggcagcgagcagacgtccggcaccgcgaccgaaggcccgaag
aaattcgcggtcgacggcaacaccagcacgtactggcattccaactggacgcccaccacc
gtgaacgacctgtggatcgccttcgagctccagaaacccaccaagctcgacgcgctgcgc
tacctgccgcgccccgcgggcagcaagaacggctccgtcaccgaatacaaggttcaggtc
agcgatgacggcaccaactggaccgacgcgggctccggcacatggaccaccgattacggc
tggaagctcgccgagttcaatcagccggtgaccaccaagcacgtgcggctcaaggccgtc
cacacctatgcggattccggcaacgacaagttcatgtccgcctccgaaatccgcctgcgc
aaggccgtcgacaccaccgacatcagcggcgcgaccgtgaccgtgcccgccaagctgacc
gtcgaccgggtggacgccgaccatcccgccaccttcgccacgaaggacgtgacggtgacg
ttgggcgacgccacgctgcgctacggcgtggactacctgctcgactacgcgggcaacacc
gccgtcggcaaggccacggtgaccgtacgcggcatcgacaagtactccggcaccgtcgcc
aagacgttcaccatcgaactgaaggacgccccggcgccgaaaccgacgctgacctcggtg
agcgtcaagaccaagccttccaagctgacctatgtggtcgacgacaagttcgacccggca
ggactggtgctgcagctcaactatgacgacgacagcaccggcaccgtgacctggaacacg
cagacggccggcgacttcacgttcaagcctgcgctcgacgcgaagctcaaggtcaccgac
aagaccgtcaccgtcacctaccagggcaagtccgcggtcatcgacatcaccgtctcgcag
cccgccccgaccgtcagcaagacggatctggacaaggccatcaaggcgatcgaggccaag
aacccggattcatccaagtacacggccgactcgtggaagaccttcgcggacgccatggcg
catgccaaggccgtcatcgcggatgattccgccacccagcaggacgtcgataacgcgctc
aaggcgctgaccgacgcctacgccgggctgaccgagaagacgcccgaacccgcccccgtc
agcaagtccgagctggacaagaagatcaaggcgatcgaggccgagaagctggacgggtcg
aagtacacggccgactcgtggaaggcgttcgagaccgccctggcgcatgccaaggccgtc
atcgccagcgattccgccacccagcaggatgtggacgcggcccttggcgccctgacctcc
gctcgcgacggactgaccgagaagggcgaagtcaagcccgacccgaagcccgaaccgggc
accgtcgacaaggcggcgctggataaggcggtcaagaaggtcgaggccgagaagctggac
gggtcgaagtacacggccgactcgtggaaggcgttcgagaccgccctggcgcatgccaag
gccgtcatcggcaacgccaactccacgcagttcgacatcgacaacgcgctgtcgatgctc
aacgacgcccgcgccgcgctcaaggagaagcccggccgcatcatcgccatcatcgatggc
agcgcactgagcaagaccggcgcatccgtcgccatcatcgcctccgtcgcggccgcgatg
ctggcggtcggtgccggcgtcatggcgttgcgccgcaagcgctcctga

DBGET integrated database retrieval system