KEGG   Bifidobacterium bifidum PRL2010: BBPR_0581Help
Entry
BBPR_0581         CDS       T01340                                 

Gene name
mur
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--lysine ligase (EC:6.3.2.7)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BBPR_0581 (mur)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BBPR_0581 (mur)
Enzymes [BR:bbp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BBPR_0581 (mur)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(730720..732279)
Genome map
AA seq 519 aa AA seqDB search
MTVTLASAAQLLKRHGLLREIIRADRWTLDAHDIEGADTAFSAITYDTRDVREGTLLCCK
GRFKAEYLHDIDERGLAAYVADTDFSAETGAPGLIVNDARKAMSLLSAEFYGRPQDELTV
VGITGTKGKTTTAYFTQAVLNAHSHGKAALFSSVDNCLDGHTYVESDLTTPESMDAFRMM
REAADNGMKYLVMEVSSQAYKVERVYGLTFDVATFLNISPDHISPIEHPTFEDYLYCKRQ
IVCNSRALVLGAASDHADLLRQDAADAGVPVTTFELLDGQSPAGSDAAYVTASPANAEHS
AYRIAAGGADLGEFRLALDGDFNYANAAAALAIAHAAGIDLTADAAATHAMEPVRIAGRM
EQFHDPQSNTLAIVDYAHNYASVTALLDFVDERFGSQHPRITLVTGSAGNKAYDRRKEIV
EAAQHRIDSFIFTAEDTDTEPFIDICMEMQRYITVPGIASTVISDRPSAVTNAIYDARAH
ADRFNIILIIGKGDERWIKDHNKHVPFEGDDRIVERMFA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgacggtaacgttggcatcggcggcgcaactgctcaagcggcacggtctgcttcgggag
atcatccgcgcggatcgttggacgcttgatgcgcacgacatcgaaggggctgacaccgct
ttttcggcgatcacctatgacacgagggacgtgcgcgagggcacgctgctgtgctgcaag
gggcggttcaaggccgagtatctgcatgacatcgacgagcgcgggctggccgcatacgtg
gccgacaccgatttttcggcagagaccggcgcacccggcctgatcgtcaatgacgcgcgc
aaggccatgagcctgctgtccgcggagttctatggacgaccgcaggacgagctgaccgtg
gtcggcatcaccggcaccaagggcaagactacgaccgcgtacttcacccaggccgtgctg
aacgcccactcgcacggcaaggcagcgctgttctcctccgtggacaactgcctggacggg
cacacgtacgtcgagtccgacctgaccacgcccgagtcgatggacgctttccgcatgatg
cgagaggccgctgacaacggcatgaagtacctcgtcatggaggtctcctcgcaggcgtac
aaggtcgagcgcgtgtacgggctgacgttcgacgtggccacgttcctgaacatctccccc
gaccatatcagcccgatcgagcatccgacgttcgaggattacctgtattgcaagcgccag
atcgtgtgcaacagccgcgcgctggtgctcggcgcggccagcgatcatgccgacctgctg
cgtcaggacgcggcggacgccggcgtgccggtcaccacgttcgagctgctggacgggcag
agccccgccggatccgatgccgcctatgtcaccgcaagcccggcgaacgccgagcacagc
gcctaccgtatcgccgcaggcggcgctgatctcggcgagttccgtctggcgttggacggc
gacttcaactacgccaacgcggcagcggcgctggccatcgcgcatgccgccggaatcgac
ctgaccgccgacgccgcggccacgcacgcgatggagccggtgcgcatcgccggccgcatg
gagcagttccacgacccgcagtccaacacgctggcgatcgtcgactacgcgcacaactac
gcctccgtgaccgcgctgctcgatttcgtcgacgagcggttcggctcgcagcacccgcgc
atcacgcttgtcaccggttcggccggcaacaaggcgtacgaccggcgcaaggagatcgtc
gaagcggcgcagcatcgcatcgacagcttcatcttcaccgccgaggacacggacaccgaa
ccgttcatcgacatctgcatggagatgcaacggtacatcaccgtgcccggcatcgcgtcc
accgtcatctccgaccgcccgagcgccgtcacgaacgcgatctacgacgcccgagcgcac
gccgaccggttcaacatcatcctcatcatcggcaagggtgacgaacgctggatcaaggac
cacaacaagcacgtgccgttcgagggcgacgaccgcatcgtcgagcgcatgttcgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system