KEGG   Bifidobacterium bifidum PRL2010: BBPR_0679Help
Entry
BBPR_0679         CDS       T01340                                 

Gene name
ppgK
Definition
polyphosphate glucokinase/Transcriptional regulator (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBPR_0679 (ppgK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBPR_0679 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    BBPR_0679 (ppgK)
Enzymes [BR:bbp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     BBPR_0679 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
842105..842866
Genome map
AA seq 253 aa AA seqDB search
MIDTAQAFGVDIGGSGIKAAPVDLNKGEFAEPRLKILTPSESTPQAIGSVLRKQLEHFEV
PETAPVGISFPAPVKPGQKLNWIANLDQSWVGVDITEALSEECGRPVTVVNDADAAGLAE
QQFGAAKGQEGLVVVTTLGTGIGTALIYDGVLIPNTELGHIELEGGKGDAERYASSAVRE
RKELSYKKWAKRLTKYYSLIEKYFSPSLIVIGGGVSRKSDNFVPFIDIDTPIVPAKLRNE
AGIIGAAYYASTK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgattgataccgctcaagcgtttggcgtggatatcggcggatccggtatcaaggccgct
ccggtcgacctgaacaagggggagttcgccgagcccaggctgaagatcctcaccccgtcc
gagtccaccccgcaggcgatcggatcggtgctgcgcaagcagctcgaacatttcgaggtt
ccggagacggctccggtcggcatctctttccccgctccggtcaagcccggccagaagctg
aattggatcgccaacctcgaccagtcgtgggtaggcgtcgacatcaccgaggcgctgtcc
gaggagtgcggccgtccggtcacggtcgtcaatgacgccgatgccgccggcttggcggaa
cagcagttcggcgcggccaagggtcaggagggtctggtcgtcgtgaccacgctcggtacc
ggcatcggcacggcgctgatctatgacggcgtgctcatcccgaacaccgagctcggccac
atcgagttggagggcggcaagggcgacgccgagcgctacgcatcctccgcggtgcgcgag
cgcaaggagctcagctacaagaagtgggccaagcgtctgaccaagtactacagcctgatc
gaaaagtacttcagcccctcgctgatcgtcatcggtggtggcgtgagccgcaagagcgac
aacttcgtgccgttcatcgacatcgatacgccgatcgtccccgcgaagctgcgcaacgag
gccggcatcatcggtgccgcctactacgccagcaccaagtag

DBGET integrated database retrieval system