KEGG   Bifidobacterium bifidum PRL2010: BBPR_0679Help
Entry
BBPR_0679         CDS       T01340                                 

Gene name
ppgK
Definition
(RefSeq) polyphosphate glucokinase/Transcriptional regulator
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
bbp00010  Glycolysis / Gluconeogenesis
bbp00520  Amino sugar and nucleotide sugar metabolism
bbp01100  Metabolic pathways
bbp01110  Biosynthesis of secondary metabolites
bbp01120  Microbial metabolism in diverse environments
bbp01130  Biosynthesis of antibiotics
bbp01200  Carbon metabolism
Module
bbp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBPR_0679 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    BBPR_0679 (ppgK)
Enzymes [BR:bbp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     BBPR_0679 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-GeneID: 9888826
NCBI-ProteinID: YP_003970806
UniProt: A0A0H3EBW3
Position
842105..842866
Genome map
AA seq 253 aa AA seqDB search
MIDTAQAFGVDIGGSGIKAAPVDLNKGEFAEPRLKILTPSESTPQAIGSVLRKQLEHFEV
PETAPVGISFPAPVKPGQKLNWIANLDQSWVGVDITEALSEECGRPVTVVNDADAAGLAE
QQFGAAKGQEGLVVVTTLGTGIGTALIYDGVLIPNTELGHIELEGGKGDAERYASSAVRE
RKELSYKKWAKRLTKYYSLIEKYFSPSLIVIGGGVSRKSDNFVPFIDIDTPIVPAKLRNE
AGIIGAAYYASTK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgattgataccgctcaagcgtttggcgtggatatcggcggatccggtatcaaggccgct
ccggtcgacctgaacaagggggagttcgccgagcccaggctgaagatcctcaccccgtcc
gagtccaccccgcaggcgatcggatcggtgctgcgcaagcagctcgaacatttcgaggtt
ccggagacggctccggtcggcatctctttccccgctccggtcaagcccggccagaagctg
aattggatcgccaacctcgaccagtcgtgggtaggcgtcgacatcaccgaggcgctgtcc
gaggagtgcggccgtccggtcacggtcgtcaatgacgccgatgccgccggcttggcggaa
cagcagttcggcgcggccaagggtcaggagggtctggtcgtcgtgaccacgctcggtacc
ggcatcggcacggcgctgatctatgacggcgtgctcatcccgaacaccgagctcggccac
atcgagttggagggcggcaagggcgacgccgagcgctacgcatcctccgcggtgcgcgag
cgcaaggagctcagctacaagaagtgggccaagcgtctgaccaagtactacagcctgatc
gaaaagtacttcagcccctcgctgatcgtcatcggtggtggcgtgagccgcaagagcgac
aacttcgtgccgttcatcgacatcgatacgccgatcgtccccgcgaagctgcgcaacgag
gccggcatcatcggtgccgcctactacgccagcaccaagtag

DBGET integrated database retrieval system