KEGG   Bifidobacterium bifidum PRL2010: BBPR_0696Help
Entry
BBPR_0696         CDS       T01340                                 

Definition
glycoside hydrolase, family 3 domain-containing protein (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BBPR_0696
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    BBPR_0696
Enzymes [BR:bbp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BBPR_0696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(867173..868459)
Genome map
AA seq 428 aa AA seqDB search
MQQIKHGGRRPRPSSAPTIIAAMLCVVALVTAGTAWWMLRPQQKDTLEHLAQPQSSSSTL
NRDKAPTPKPQKSQEHQKAADDSPAAKASRAIATMSLDERAGQLIMAPMFAGGNPADLSA
LISTRHVGSVVLIGNWNNGTAAAKTAADALQSYAPSGNQLIVSTDQEGGQVQHLKGSGFD
TMPSAVAQGQMSADTLRSSAKTWGGQLKQAGINIDLAPVLGTVQVKRSSNAPIGALNRDF
GLDSNGNAQHGIAFVEGMRDAGVGATVKHYPGLGAVTGNTDFTTEGILDTTTTLDDEEIG
AFNTTIKQAKPAMVMMSLATYQRIDSSAPAAFSSKIIDGTLRGSVGYDGVVISDSLSAAA
VSGIATKDLGVRLVDAGGDLACIGDTSYVTPILDGIIARAQSDPAFAKKVTASATRVMTL
KYQMGLAK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagatcaaacacggcggcaggaggccgcgccccagttcagcccccaccatcatc
gcggccatgctctgcgtggtggcccttgtgacggcaggcacggcatggtggatgctgcgt
ccccagcaaaaagacacgctcgaacatctcgcgcagccacagtcctcctcttcgacgctg
aaccgcgacaaggcccccacaccgaaaccgcagaaatctcaggagcatcagaaggcagcc
gatgactcccccgcggccaaggcgagccgcgccatcgccacgatgagtctcgatgaacgg
gccgggcagctcatcatggcaccgatgttcgcaggcggcaatccggccgatctcagcgcc
ctcatcagcacacgccatgtcggttccgtggtgctcatcggcaactggaacaacggcaca
gccgcagccaagaccgccgctgacgcgctgcaaagctatgctccgagcggcaaccagctg
atcgtctccaccgatcaggaaggcggccaggtgcagcatctcaagggcagtggattcgac
acgatgccgtccgcggtggcgcagggccagatgagcgctgacacgctgcgctcctccgca
aagacctggggcggccagctcaagcaagccggcatcaacatcgacctggccccggtattg
gggacggtgcaggtcaagcgttcctcgaacgctccgattggcgcgctgaaccgcgatttc
ggtttggattccaacggaaacgcgcagcacggcatcgcgttcgtcgaaggcatgcgcgac
gcgggcgtcggcgcgaccgtcaagcactaccccggtttgggcgcggtgaccggcaatacc
gatttcacgaccgagggcatcctcgacaccacgaccacgcttgatgacgaggagataggc
gcgttcaacaccacgatcaagcaggcgaagccggctatggtgatgatgtcgctggcgacc
taccagcgcatcgactcgtcggcgcccgccgcgttctccagcaagatcatcgacggcacg
ctgcgcggcagcgtcggctatgacggcgtggtgatctcagactccctttcggccgcggcg
gtcagcggcatagcgaccaaggacctgggcgtgcgtctggtggacgccggcggcgatttg
gcgtgcataggcgatacgtcatatgtgacgccgattcttgacggtatcatcgcccgtgcg
cagtccgacccggccttcgcgaagaaggtgacggcctccgcgacgcgcgtgatgaccctg
aaataccagatgggactggcgaagtga

DBGET integrated database retrieval system