KEGG   Bifidobacterium bifidum PRL2010: BBPR_0787Help
Entry
BBPR_0787         CDS       T01340                                 

Gene name
glmS
Definition
glucosamine--fructose-6-phosphate aminotransferase GlmS (EC:2.6.1.16)
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bbp00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bbp00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
975147..975674
Genome map
AA seq 175 aa AA seqDB search
MCGIVGYAGNVSATCGKPPQVCLQGLQRLEYRGYDSAGVALVASGMGHAVVHKKAGRLAN
LVESVERNPMPPATAAIGHTRWATNGAPSDMNAHPHPLRTLVVAISQSEETMDTLMALRH
VREQGSMVLSICNTQVASIPRESDAVRSSTRSMACRPRSNGCSTRRQARPDSAGR
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgtcggatatgcaggtaatgtttcggccacgtgcggcaagccccctcag
gtgtgtcttcagggattgcaacgcctggaataccgcgggtacgactctgcgggagtggcg
ctcgtcgcttcgggcatggggcatgcagtggtgcacaagaaggccggaaggctcgccaat
ctcgtcgaaagcgtggaacgtaacccgatgccgcccgcgacggccgccatcggacacacc
cgctgggccacgaacggggcgccctccgacatgaacgcccatccccaccccctgcgtacg
ctggtcgtggcgatatcgcagtccgaagagactatggacacgctgatggccctgcgccac
gtgcgcgagcagggatccatggtgctgtcgatctgcaacacgcaggtggcgtcgataccg
cgcgaatccgatgccgtcagatcatcgactcgctcaatggcatgccggccaagatccaat
gggtgctcgacacgcaggcaggcacggcccgatagcgctggtcgatga

DBGET integrated database retrieval system