KEGG   Bifidobacterium bifidum PRL2010: BBPR_0840Help
Entry
BBPR_0840         CDS       T01340                                 

Definition
aminotransferase (EC:2.6.1.1)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    BBPR_0840
   01230 Biosynthesis of amino acids
    BBPR_0840
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BBPR_0840
   00290 Valine, leucine and isoleucine biosynthesis
    BBPR_0840
Enzymes [BR:bbp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BBPR_0840
    2.6.1.66  valine---pyruvate transaminase
     BBPR_0840
Amino acid related enzymes [BR:bbp01007]
 Aminotransferase (transaminase)
  Class I
   BBPR_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1033265..1034833
Genome map
AA seq 522 aa AA seqDB search
MESFATRLRTAMNARHLRQVDIVRAAQASGVKLGKSHISQYVSGKTTPRADTLRFLADTL
QVDEQWLLGHDRGRPGMPAQPKRVPDNPGGRADAPRTPSSQAPAPQTTSPSHEPEGTPMR
HFNKSTKLDNVLYDVRGPVVDEAARMEQSGMHVLKLNIGNPAPFGFRTPDEVVYDMSRQL
SDTEGYSASKGLFSARKAIMQYAQLKNLPNVGIEDIYTGNGVSELINLSLSALLDNGDEV
LVPSPDYPLWTACVNLAGGTAVHYVCDEESEWYPDIDDMRSKITDRTVAIVLINPNNPTG
ALYPKEVLQQIVDLAREHQLMIFSDEIYDRLVMDGLQHVSIASMAPDLFCVTFSGLSKSH
MIAGYRIGWMVLSGNKSIAKDYVEGINMLTNMRICSNVPAQSIVQTALGGHQSVNDYIVP
GGRLYEQREYIYNALNSIPGVTAVKPKAAFYIFPKLDVKKFNITDDEQFALDLLHDKRIL
ITRGGGFNWHEPDHFRIVYLPRIEVLKDATEKLTDFLSCYRQ
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
ttggagagcttcgcgacgcggctgagaaccgccatgaacgcccgtcacctcagacaggtc
gacatcgtgcgtgccgcccaggcgtcaggtgtcaaactcggcaaaagccacatcagccaa
tatgtcagcggcaagacgacgccccgcgcggatacgctcaggttcctcgccgatacactg
caggtcgacgagcaatggctgctcggccatgatcgcggacggcccggcatgccggcgcag
ccgaaacgggtgccggacaatcccggcggccgggccgacgcgccacgcacgccatcatcc
caagcgcccgcaccccagacaacgtcaccatcacacgaaccggaaggaacacccatgcgc
cacttcaacaaatccaccaaacttgacaacgtgctgtacgacgtgcgcggaccggtcgtc
gacgaggccgcccgcatggagcagtccggcatgcacgtgctcaagctcaacatcggcaac
cccgcgccgttcggcttccgcacaccggacgaggtcgtatacgacatgtcccggcagctc
agcgacacggaaggctactccgcgtccaagggcctgttctcggcgcgcaaggcgatcatg
cagtacgcgcagctcaagaacctgcccaatgtcggcatcgaagacatctacaccggcaac
ggcgtcagcgagctgatcaacctgtcgttgtccgccctgcttgacaacggcgacgaggtg
ctggtgcccagccccgactacccgctgtggaccgcctgcgtcaacctggccggcggcacc
gccgtgcactacgtgtgcgacgaggaatccgaatggtacccggacatcgatgacatgcgc
agcaagatcaccgaccgcacggtggcgatcgtcctgatcaacccgaacaacccgaccggc
gccctctacccgaaggaggtgctgcagcagatcgtcgatctggcccgcgaacaccagctg
atgatcttctccgacgagatctacgaccgtctggtgatggacggactccagcacgtctcg
atagcgtccatggccccggacctgttctgtgtcacgttctccggcctgtcgaagtcgcac
atgatcgcgggctaccgcatcggatggatggtgctcagcggcaacaagtccatcgcgaag
gactatgtcgagggcatcaacatgctcaccaacatgcgcatctgctcgaacgtgcccgcc
cagtcgatcgtgcagaccgctctcggcggccaccagagcgtcaacgactacatcgtgccc
ggcggccgtctgtacgagcagcgcgaatacatctacaacgcgttgaactcgattcccggc
gtcaccgcggtcaagccgaaggccgcgttctacatcttccccaagctcgacgtgaagaag
ttcaacatcactgatgatgagcagttcgcgcttgacctgctgcatgacaagcgcatcctc
atcacgcgcggcggcgggttcaactggcatgagccggaccacttccgcatcgtctacctg
ccgcgcatcgaagtgctcaaggacgcgacggaaaagctcaccgacttcctcagctgctac
cggcagtag

DBGET integrated database retrieval system