KEGG   Bifidobacterium bifidum PRL2010: BBPR_0945Help
Entry
BBPR_0945         CDS       T01340                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.284)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BBPR_0945 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBPR_0945 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    BBPR_0945 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BBPR_0945 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BBPR_0945 (adh)
   00626 Naphthalene degradation
    BBPR_0945 (adh)
Enzymes [BR:bbp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BBPR_0945 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1126095..1127138
Genome map
AA seq 347 aa AA seqDB search
MIEMMKAVIFVEPGKMTVEEVPKATLRQDDDIVIRVVRTCVCGSDLWFFRGLSRQAAHSQ
VGHESIGVVEEVGAAVESVKPGDFVVVPFPYSCGKCPVCKAGFESVCPHGGYFSACQAEY
LRVPEADGTVVKVPGSSEDYDDATLASLLTISDVMSTGYHAAASADVKPGDTAVVIGDGA
VGLCGVIAAKMRGATRIIAMSRHEDRAALACEFGATDIVPERDQAAVDKVLGMTGGYGAD
AVLECVGSKQSFDTAIGLIRRGGVIGRVGLPHDVVISAEGTFYGNIGIKGGPAPVRHYDL
DAGLLDAVLEGRINPGRVFTAEYDLDHIQDAYEAMDQRKVIKALIRL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaatgatgaaggctgtgatattcgtggagcccggcaagatgaccgtcgaggag
gtgccgaaggcgacgcttcggcaggacgacgacatcgtgattcgcgtggtgcgcacttgc
gtgtgcggttccgatttgtggttcttccgtgggctgagcagacaggccgcacacagccag
gtgggtcacgagtccatcggtgtggtcgaagaggttggcgcggcggtcgaatccgtcaag
cccggcgacttcgtggttgtgccgttcccgtacagttgcggcaagtgcccggtgtgcaag
gccggctttgaatccgtgtgcccgcacggcggctacttctccgcctgtcaggccgaatac
ctgcgcgtaccggaggcggacggcaccgtggtcaaggtgcccggttcgtcggaagactac
gacgacgcgacgctcgcttcgctgctgaccatttccgatgtgatgtccaccggttatcac
gcggcggcttctgccgatgtcaagcccggtgacaccgccgtggtcatcggcgatggcgca
gttggcctgtgcggtgtgattgccgccaagatgcgcggtgccacgcgcattattgccatg
agccgtcacgaggatcgcgcggcgctcgcctgcgaattcggtgcgactgatatcgtgccc
gagcgcgatcaggccgccgtcgacaaggtgctggggatgaccggcggctatggtgccgac
gctgtgctcgaatgcgtgggctccaagcagtccttcgacacggcgatcggtctgatccgt
cgtggtggcgtgatcggccgcgtgggcctgccgcatgatgtggtaatcagcgccgaaggc
acgttctacggcaacatcggcatcaagggcggcccggctcccgtgcgccactatgatctt
gacgccggtctgctggacgcggtgcttgaggggaggatcaaccccggtcgcgtgttcacc
gccgagtacgacctcgaccacatccaggacgcctatgaggccatggaccagcgcaaggtg
attaaggcgctgattcgcctctag

DBGET integrated database retrieval system