KEGG   Bifidobacterium bifidum PRL2010: BBPR_0976Help
Entry
BBPR_0976         CDS       T01340                                 

Gene name
ugpA
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BBPR_0976 (ugpA)
   00052 Galactose metabolism
    BBPR_0976 (ugpA)
   00500 Starch and sucrose metabolism
    BBPR_0976 (ugpA)
   00520 Amino sugar and nucleotide sugar metabolism
    BBPR_0976 (ugpA)
Enzymes [BR:bbp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BBPR_0976 (ugpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1155655..1157121
Genome map
AA seq 488 aa AA seqDB search
MFAEDLKRTEKMTVDDVFEQSAQKMREQGMSEIAISQFRHAYHVWASEKESAWIREDAVE
PLHGVRSFHDVYKTIDHDKAVHAFAKTAFLKLNGGLGTSMGLQCAKSLLPVRRHKARQMR
FLDIILGQVLTARTRLNVPLPVTFMNSFRTSDDTMKALRHQRKFKQTDIPLEIIQHQEPK
IDAATGAPASWPANPDLEWCPPGHGDLFSTLWESGLLDTLLEHGFEYLFISNSDNLGARP
SRTLAQYFEDTGAPFMVEVANRTYADRKGGHIVRDTATGRLILREMSQVHPDDKDAAQDI
AKHPYFNTNNIWVRIDVLRVMLAEHDGVLPLPVIINNKTVDPTDPQSPAVVQLETAMGAA
IGLFEGAICVQVDRMRFLPVKTTNDLFIMRSDRFHLTDSYEMEDGNYIFPNVDLDPRYYK
NIEDFNERFPYNVPSLAAANSVSIKGDWTFGRDVIMFADARLEDRNEPSYVPNGEYVGPM
GIEPGDWV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccgaagatctgaaacggacggagaagatgacagtggacgacgtgttcgagcag
tcggcgcagaagatgcgcgagcagggcatgagcgagatcgccatctcgcagttcaggcac
gcataccatgtgtgggccagcgagaaggagagcgcgtggatccgcgaggacgccgtcgag
ccgctgcacggcgtgcggagcttccatgacgtgtacaagaccatcgatcatgacaaggca
gtgcacgcgttcgccaagactgcattcctcaagctcaacggcggcctgggaacctcgatg
ggcctgcaatgcgcgaagtcgctgctgccggtgcgccgccacaaggctcggcagatgcgc
ttcctcgacatcatcctcggtcaggtgctcaccgcgcgcacgaggctgaacgtgcctctg
ccggtcacgttcatgaactcgttccgcacttcggatgacacgatgaaggcactgcgacac
cagcgcaagttcaagcagaccgacatcccgctggagatcatccagcatcaggaaccgaag
atcgacgcggccaccggggcgccggcgtcttggccggccaaccccgatctggagtggtgc
ccgcccggccacggcgacctgttctcgacgctgtgggagtccggcctgctggacactctg
ctggagcatggcttcgaatacctgttcatctcgaactccgacaatttgggtgcgcgcccg
tctcgcacgctcgcccagtatttcgaggatacgggcgccccgttcatggtcgaggtcgcc
aatcgcacgtacgcggaccgcaagggtggccatatcgtgcgcgacacggccaccggccga
ctgatcctgcgggagatgtcgcaggtgcatcctgacgacaaggacgcggcccaggacatc
gccaagcacccgtatttcaacacgaacaacatctgggtgcgcatcgacgtgctgcgcgtc
atgctcgccgagcatgacggcgtgctgccgcttcccgtcatcatcaacaacaagaccgtc
gacccgaccgacccccagtccccggcggtggtccagctggagactgcgatgggcgcggcg
atcggcctgttcgaaggcgcgatctgtgtgcaggtggaccgcatgcggttcctgccagtg
aagacgaccaacgacctgttcattatgcgttccgatcggttccaccttacggactcgtat
gagatggaggacggcaactacattttcccgaacgtcgacctcgatccgcggtactacaag
aacatcgaggacttcaacgaacggttcccctacaacgtgccgtcgctcgccgccgcgaac
tcggtcagcatcaagggagactggacattcggacgtgacgtcatcatgttcgccgacgcg
cgtctggaggatagaaacgagcccagttacgtacccaacggcgaatacgtcggaccgatg
ggcatcgagcccggtgattgggtgtga

DBGET integrated database retrieval system