KEGG   Bifidobacterium bifidum PRL2010: BBPR_1000Help
Entry
BBPR_1000         CDS       T01340                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BBPR_1000 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBPR_1000 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BBPR_1000 (trpA)
Enzymes [BR:bbp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BBPR_1000 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1174590..1175468)
Genome map
AA seq 292 aa AA seqDB search
MIMTNTATTPSGQPLGISHKPSATEAMFDRLKAENKPAFIGYLPYGFPNPDISLDALRIM
VEHGVDAVEIGLPYSDPVMDGPVIQAASQIALNNGESINGVFKAVETVANAGGVPLIMSY
WNLIYHYGVERFACDFENAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSASER
LELVARNARGFVYAASRMGVTGERDTISASPETLVERARNAGARNVCVGIGVSTPEQGAK
VGAYADGVIVGSALVHTLLDDDNVTAKTPKEGLRDLAAKVEALSEGIHNESR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgattatgacgaatacagcaaccacaccgtccggacagccgctcggcatcagtcacaag
cccagcgcgacggaagccatgttcgaccggctcaaggccgagaacaagccggccttcatc
ggatacctgccgtatggcttcccgaaccccgacatctcactcgacgcgctcaggatcatg
gtcgagcacggcgtcgacgcggtcgagatcggcctgccgtactccgacccggtgatggac
ggtcccgtcatccaggcggccagccagatcgccctgaataacggggaaagcatcaacggc
gtgttcaaggcggtcgagacggtggccaacgccggcggcgtgccactcatcatgagctac
tggaacctgatctaccattacggcgtcgaacggttcgcctgcgatttcgagaacgccggc
ggtgccggcctgattacccccgacctcatccccgatgaggctggcgagtggatcgaggct
tcggatcgtcacggactcgaccgcatcttcctggtctccccggattcggcctccgaacgt
ctcgaactggtcgcccgcaacgcacgcggcttcgtctacgcggcatcccgtatgggcgtt
accggcgagcgcgacaccatcagcgcatcgcccgaaacgcttgtcgagcgtgcccgcaac
gccggggcgagaaacgtgtgcgtgggtatcggcgtatccaccccggagcagggcgcgaag
gtcggcgcctacgccgacggcgtcatcgtcggttctgctctggtgcacaccctgcttgac
gacgacaacgtcaccgcgaaaacgccgaaggaaggactgcgcgacctggccgccaaggtc
gaggcgctgtccgagggcatccacaacgagtcacgctga

DBGET integrated database retrieval system