KEGG   Bifidobacterium bifidum PRL2010: BBPR_1001Help
Entry
BBPR_1001         CDS       T01340                                 

Gene name
trpBC
Definition
(RefSeq) bifunctional protein, includes tryptophan synthase subunit beta and indole-3-glycerol phosphate synthase
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBPR_1001 (trpBC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BBPR_1001 (trpBC)
Enzymes [BR:bbp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BBPR_1001 (trpBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1175495..1177582)
Genome map
AA seq 695 aa AA seqDB search
MSVLDELVAGALEDQRSRECVVSLEDVRRAALAAPAPIDATRWLKRPDGIPVIAEIKRAS
PSKGHLSDIPDPAALAREYERGGASAISVLTEGRRFLGSLDDFDKVRSAVHIPLLRKDFI
VTDYQIYEARAHGADLVLLIVAALDDDKLAHLLELAHELGMAVLVETHTTEEIRRAVAAG
ARIIGINARNLKNLKVDVNKYAELAEGLPDDVIRVAESGVFGSVEVEDYGRAGADAVLVG
EGVATADDHVAAVQRLVKAGQRVKASESTPLSEHQGPYWGQFGGRYVPEALITALDELER
VYDQAKADPEFRKEFMTLQHRYVGRPSPLTEAPRFAALVKDRTGLDARIFLKREDLNHTG
AHKINNALGQALLVKRMGKTRVIAETGAGQHGVATATVCAMLGLKCRVYMGQIDARRQAL
NVARMRMLGAEVVEVTLGDKILKDAINEALRDWVTNVADTHYLLGTVAGPHPFPAMVRDF
QKIIGEEAKQQLQDWYGIDHPDAVCACVGGGSNAIGVMNAFLDDERVNLYGYEAGGNGPA
SGHHAIRFAPGTGQLGMFQGAKSYLLETDEGQTLDTYSISAGLDYASVGPEHAWLKEIGR
VNYSWATDEEAMNAFRDLSQTEGIIPAIESSHAVAGAFKAAADLKAKGYDKAVMIVNISG
RGDKDMATAGKWFGYLTDEQAAALDVTGAQGDTVA
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttttggacgaattggttgccggggcgttggaagaccagcgttcccgcgaatgt
gtcgtgtctcttgaggatgtgaggcgggccgctctggccgcgccggcgcctatcgacgcg
acgcgatggctcaagcgtccggacggcatccccgtgatcgccgaaatcaagcgcgcctcc
ccatccaaggggcatttgagcgatatccccgacccggcggccctggcccgcgaatacgag
cgcggcggtgcgagcgcgatttccgtgctcaccgaaggccggcggttcctcggctcgctg
gacgatttcgacaaggtccgctcggcggttcacattccgctgctgcgcaaggacttcatc
gtcaccgactaccagatctacgaggcgcgtgcccacggcgccgacctagtgctgctcatc
gtcgccgcgctggatgacgacaagctcgcgcacctgcttgaactcgcccacgagctcggc
atggctgtgctcgtcgaaacgcacaccaccgaggagatccgccgcgcggtcgcggccggc
gcccggatcatcggcatcaacgcgcgcaatctcaagaacctgaaggttgacgtgaacaaa
tacgccgaactcgccgaaggactgcccgatgacgtgatccgcgtcgcagagtcgggcgtg
ttcggttcggtcgaggtcgaggattacggtcgcgccggcgcggatgccgtgctggtgggc
gaaggcgtggctaccgccgacgaccatgtggccgccgtacaacgactagtaaaggcaggt
cagagagtgaaagcatccgaatcgaccccgttgagcgagcatcagggaccatattgggga
cagttcggcgggcgatacgtgccggaggcactgatcaccgctctggacgagctggagcgc
gtctatgatcaggccaaggccgaccccgagttccgtaaggaattcatgacgttgcagcat
cggtacgtcggccgtccgagcccgctgacggaagccccgcgattcgccgcgctggtcaag
gacaggaccggactcgacgcccgcatcttcttgaagcgcgaggacctcaaccacaccggc
gcgcacaagatcaacaacgcgctcggccaggcgttgctcgtcaagcgcatgggcaagacc
cgcgtgatcgccgagaccggtgccggacagcacggcgtggccaccgccaccgtgtgcgcg
atgctagggctcaagtgccgcgtgtacatggggcagatcgacgcccgacgtcaggccctc
aacgtggcccgcatgcgcatgctgggcgccgaggtcgtcgaagtgacactgggcgacaag
attctcaaggatgcaatcaacgaggcgctgcgcgattgggtgaccaacgtcgccgacacg
cactacctgctcggcacggtcgccggaccgcacccgttcccggccatggttcgcgatttc
cagaagatcatcggcgaggaggccaagcagcaacttcaggactggtacggcatcgaccac
ccggacgcggtgtgcgcgtgcgtcggtggcggatccaacgccatcggcgtgatgaacgcg
ttcctcgacgacgagcgcgtgaacctgtacggctatgaggcgggcggcaacgggccggcc
tcgggccatcatgcgatccgtttcgcaccgggcaccggacagctcggcatgttccagggt
gccaagagctacctgttggagaccgatgaaggacagactctcgacacgtattcgatttcg
gccggtctcgattacgcttccgtcggccccgagcacgcttggctcaaggagatcgggcgc
gtgaactactcctgggccaccgacgaggaggctatgaacgccttccgcgacctgagccag
accgagggcatcatccccgccatcgagagctcgcatgccgtcgctggcgccttcaaggcc
gccgctgatctgaaggccaagggatacgacaaggccgtgatgatcgtcaacatctccggc
cgcggcgacaaggacatggccaccgcgggcaaatggttcggatacctgaccgacgagcag
gccgcggcgctcgatgtcaccggcgcgcagggcgacaccgtcgcctga

DBGET integrated database retrieval system