KEGG   Bifidobacterium bifidum PRL2010: BBPR_1037Help
Entry
BBPR_1037         CDS       T01340                                 

Gene name
tpi
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBPR_1037 (tpi)
   01230 Biosynthesis of amino acids
    BBPR_1037 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBPR_1037 (tpi)
   00051 Fructose and mannose metabolism
    BBPR_1037 (tpi)
   00562 Inositol phosphate metabolism
    BBPR_1037 (tpi)
Enzymes [BR:bbp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BBPR_1037 (tpi)
Exosome [BR:bbp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BBPR_1037 (tpi)
  Exosomal proteins of bladder cancer cells
   BBPR_1037 (tpi)
  Exosomal proteins of melanoma cells
   BBPR_1037 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1218397..1219191)
Genome map
AA seq 264 aa AA seqDB search
MASRIPLLAGNWKMNLDHLEATYFVQKLVWLLRDARFDYSRCEIALMPSFTSLRSVQVLV
EADKLKIRYGAQAVSVTTQGAFTGDVSADMIAHLGCSYVIVGHSERRKYHPEDDVNIVDQ
VRAVLAAGMQPILCVGESFEERRQGIELDFAVGQVHDVTRDLSDKEAAKLIIAYEPVWAI
GTGMVATPDTAQQAAKAIRDDLGEMFGPAVADTVRILYGGSVSSKNATHLIGEPDVDGFL
IGGASLDPGELAKIARLTLKATRR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcacgcatcccgctgctcgcgggcaattggaagatgaacctcgaccatcttgag
gccacgtatttcgtgcagaaactcgtatggctgcttcgtgacgcacgcttcgactactcc
cgctgcgaaatagccctgatgccgtcgttcacgtcgctgcgcagcgtccaggtgctggtc
gaagccgataagctcaagatccgctacggcgcgcaggccgtgtcggtgaccacacagggt
gcgttcaccggcgatgtctccgctgacatgatcgcgcacctcggctgctcgtacgtcatc
gtcgggcattccgaacgccgcaaataccatcccgaagacgacgtcaacattgtcgatcag
gtgcgtgccgtattggcggccggcatgcagccgatactgtgcgtcggagaaagcttcgag
gaacgccgccagggcatcgagctcgacttcgccgtcggacaggtgcatgacgtgacccgt
gacctttccgacaaggaggccgcgaagctcatcatcgcgtacgagccggtctgggcgatc
ggcaccggcatggtcgccactccggacaccgcccagcaggccgccaaagccatccgcgac
gacctcggcgagatgttcggccccgccgtcgccgatactgtgcgcatcctatacggcgga
tcggtgtcgtccaagaacgcgacgcatctgatcggcgagccggatgtcgatggattcctg
atcggcggcgcgtcgctcgaccccggcgaattggcgaagatcgcccggttgacactcaag
gcgacacgtcgatag

DBGET integrated database retrieval system