KEGG   Bifidobacterium bifidum PRL2010: BBPR_1123Help
Entry
BBPR_1123         CDS       T01340                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K22306  glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
bbp  Bifidobacterium bifidum PRL2010
Brite
Enzymes [BR:bbp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     BBPR_1123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 9889260
NCBI-ProteinID: YP_003971224
UniProt: A0A0H3EAJ1
Position
complement(1313841..1314563)
Genome map
AA seq 240 aa AA seqDB search
MSDVSSPQTMPEHVRSITLIRHGRTSYNARHCFQGQIDIPLDEIGEWQVRQTAQALRSLY
VESHPERRQLVVASDLSRAMATAHAFADPLGLVVHPDARVRERNFGEWEGKELAELEREC
PEDYRAWAEYRGGELRHGAETKAAVGERGRAALEEWSFSAGADTDLYVFSHGSWIAQTVQ
TVLGLGAIHPDFADVVSMGNAHWVRFVAADMPDGTLRWRLVDYNHGPALADTDQWEHPSL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgtctcctcgccgcagacgatgccggagcacgtccgctccatcacgctgata
cggcatgggcgcacctcatacaacgcccggcattgcttccaggggcagattgacatcccc
ttggatgagatcggcgaatggcaggtcaggcagaccgcgcaggcactgcgctccctatac
gtcgaatcgcacccggaacgccggcagctcgtcgtggcatccgacctgagtcgtgccatg
gccacggcgcacgccttcgccgacccgctcggactggtcgtgcaccccgacgcccgcgtg
cgggagcgcaacttcggcgaatgggaaggcaaggagctggccgaactggagcgcgaatgc
cctgaggactaccgtgcatgggcggaatatcgcggcggcgaactgcggcatggtgccgag
acgaaggccgccgtcggcgagcgaggccgcgcggcattggaggaatggtcgttcagcgcc
ggagccgacacggatctgtacgtgttctcgcatggctcatggatcgcgcagaccgtgcag
accgtgctgggattgggggctatccaccccgatttcgccgacgtggtcagcatgggcaac
gcgcactgggtgcggttcgtcgcagccgacatgcccgacggcacgttgcggtggcggctc
gtcgactacaatcatggtccggcgctcgccgacaccgaccagtgggagcatccgtcccta
tag

DBGET integrated database retrieval system