KEGG   Bifidobacterium bifidum PRL2010: BBPR_1123Help
Entry
BBPR_1123         CDS       T01340                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBPR_1123
   01230 Biosynthesis of amino acids
    BBPR_1123
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBPR_1123
  Energy metabolism
   00680 Methane metabolism
    BBPR_1123
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBPR_1123
Enzymes [BR:bbp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BBPR_1123
Exosome [BR:bbp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BBPR_1123
  Exosomal proteins of melanoma cells
   BBPR_1123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1313841..1314563)
Genome map
AA seq 240 aa AA seqDB search
MSDVSSPQTMPEHVRSITLIRHGRTSYNARHCFQGQIDIPLDEIGEWQVRQTAQALRSLY
VESHPERRQLVVASDLSRAMATAHAFADPLGLVVHPDARVRERNFGEWEGKELAELEREC
PEDYRAWAEYRGGELRHGAETKAAVGERGRAALEEWSFSAGADTDLYVFSHGSWIAQTVQ
TVLGLGAIHPDFADVVSMGNAHWVRFVAADMPDGTLRWRLVDYNHGPALADTDQWEHPSL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgtctcctcgccgcagacgatgccggagcacgtccgctccatcacgctgata
cggcatgggcgcacctcatacaacgcccggcattgcttccaggggcagattgacatcccc
ttggatgagatcggcgaatggcaggtcaggcagaccgcgcaggcactgcgctccctatac
gtcgaatcgcacccggaacgccggcagctcgtcgtggcatccgacctgagtcgtgccatg
gccacggcgcacgccttcgccgacccgctcggactggtcgtgcaccccgacgcccgcgtg
cgggagcgcaacttcggcgaatgggaaggcaaggagctggccgaactggagcgcgaatgc
cctgaggactaccgtgcatgggcggaatatcgcggcggcgaactgcggcatggtgccgag
acgaaggccgccgtcggcgagcgaggccgcgcggcattggaggaatggtcgttcagcgcc
ggagccgacacggatctgtacgtgttctcgcatggctcatggatcgcgcagaccgtgcag
accgtgctgggattgggggctatccaccccgatttcgccgacgtggtcagcatgggcaac
gcgcactgggtgcggttcgtcgcagccgacatgcccgacggcacgttgcggtggcggctc
gtcgactacaatcatggtccggcgctcgccgacaccgaccagtgggagcatccgtcccta
tag

DBGET integrated database retrieval system