KEGG   Bifidobacterium bifidum PRL2010: BBPR_1130Help
Entry
BBPR_1130         CDS       T01340                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BBPR_1130 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBPR_1130 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BBPR_1130 (thrC)
Enzymes [BR:bbp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BBPR_1130 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1320544..1322031
Genome map
AA seq 495 aa AA seqDB search
MTTFHSTRSTTDSLTSKQAIRKGIADDGGLFVTDSLGETKVDIASLTGKPYQQIAAEVLG
ALLPDFTEAELAQCIADAYGEQWSDRRITPLKPLGDDYILELFNGPTSAFKDVALQILPR
FMAHTTPADGDTDEKIMILTATSGDTGKAALAGFADAPGTAITVFYPQGKVSQVQELQMS
TQTGANVNVCAVEGNFDDAQSAVKRIFGDKELAAKLAADSHVVLSSANSINVGRLVPQVV
YYFSAYAQLLENQVINVGDEVEFVVPTGNFGDILAGYYAKMLGLPVKHLVVASDKNNVLF
DFLTTGTYNRQRPFFQTISPSMDILISSNLERMLYYMSEGDTRLISMLMNDLSQWGTYEV
PEPLLAKIRQLFGCGWADEDQVREMIADCWKKNRYVIDPHTACAYFVAQQMPRDPLTPRV
ILSTASPYKFPRVVNEALGLDADGTDFECMDVLSRETGTTAPAALRGLETADVRFKDVVP
IDGMEDYVEKAAQAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgttccacagcacgcgcagcaccaccgactcacttacctccaagcaggccatc
cgcaagggcatcgccgacgacggcggcctgttcgtgaccgattccctgggcgagacgaag
gtggacatcgcttccctgacaggcaagccgtatcagcagatcgccgccgaggtgctcggt
gcgctgctgccggacttcaccgaggccgagctcgcgcagtgcatcgccgacgcttacggc
gagcagtggtccgacaggcgcatcacgcccctgaagccgctcggcgacgactacatcctc
gaactgttcaacggcccgacctccgcgttcaaggacgttgcgctgcagatcctcccccgt
ttcatggcgcacacgacgccggcggacggcgacaccgacgagaagatcatgatcctgacc
gccacctccggcgacaccggcaaggccgcgctggccggattcgcagacgcgcccggcacc
gcgatcaccgtcttctacccgcagggcaaggtgagccaggttcaggagctgcagatgagc
acgcagaccggcgcgaacgtgaacgtgtgcgcggtcgagggcaacttcgacgacgcgcag
tccgccgtcaagcgcatcttcggcgacaaggagctcgccgcgaagctcgccgccgactcg
cacgtcgtgctctcctccgcgaactccatcaacgtgggccgtctcgtaccgcaggtcgtc
tactacttctccgcttacgcgcagctgctggagaaccaagtcatcaacgtgggcgacgag
gtcgagttcgtcgttccgaccggcaacttcggcgacatcctcgccggctactacgcgaag
atgctcggtctgccggtcaagcacctcgtggtcgcctccgacaagaacaacgtgctgttc
gacttcctgaccaccggcacgtacaaccgtcagcgtccgttcttccagacgatcagcccg
tcgatggacatcctcatctcctcgaacctggagcgcatgctgtactacatgtccgagggc
gacacccgtctgatctccatgctgatgaatgacctcagccagtggggcacgtacgaggtt
ccggagccgctgctcgcgaagatccgccagctgttcggctgcggctgggccgatgaggac
caggtgcgtgagatgatcgccgactgctggaagaagaaccgctacgtgatcgacccgcac
acggcgtgcgcgtacttcgtggctcagcaaatgccgcgcgacccgttgaccccgcgcgtg
atcctgtcgactgcgagcccctacaagttcccgcgcgtggtcaacgaggcactgggcctg
gatgccgacggcaccgatttcgaatgcatggatgtgctgtctcgcgagaccggcaccacc
gctccggccgccctgcgtggacttgagaccgccgatgtacgtttcaaggacgtcgtgccc
atcgacggcatggaggattacgtcgaaaaggccgcccaagcgctgtaa

DBGET integrated database retrieval system