KEGG   Bifidobacterium bifidum PRL2010: BBPR_1442Help
Entry
BBPR_1442         CDS       T01340                                 

Gene name
sulD
Definition
dihydroneopterin aldolase/2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:4.1.2.25)
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bbp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1698298..1699812)
Genome map
AA seq 504 aa AA seqDB search
MDTIRLTGVQGMGTHGVLDYEHQRAQPFIVDAVLHLDLSRAGSSDDLHDTVDYGRVAKRI
VSVIEGEHVDLIERLAALIADAVIADHPAVQGVTVTVHKPKAPITVPFADVSVTIERWRS
GRNTDGKTGRADEGRVTPMHHAVIALGGNKGDVAASMRSAIADIDGLEGTQVTGISPLYR
TAAWGMPDGTPDFLNAVIEVTTELDAASLLGRLQHIEVAHGRTREQHWASRTLDLDIIDV
DGLVSEDPNVTLPHPRAWQRAFVLAPWLALDPAARLAGPHGGEIADLLHEAGDREDVHRI
DDSWMTGMADDAPVQPSGSAADIPQFDGTVDGSARKPGDGDTATVQPAIHTAVISMDSRS
NEAETLFRTAIVALEGIPGDQVEGISPLYHVSHLHGSDAMSAVMQMTCRMDAKALIATLG
SVEESLNGDVDLDLVDMPGTVCDEPDCRVPWPSARTHASVLAPWMDMDPQARLGGDPVSY
LLAMAPDADRVGLLSDTWIVGSTE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtggacacgattcgcctcaccggcgttcaaggcatgggcacgcacggcgtgctggactac
gagcaccagcgcgcgcagcccttcatcgtcgatgccgtgctgcatctcgacctgtcacgt
gccggttccagcgatgacctgcatgacacggttgattacgggcgcgtcgccaaacggatc
gtatccgtcatcgaaggcgagcatgtcgacttgattgagcggctggcggctctcatcgct
gacgccgtgatagccgaccatcccgcagtccaaggcgtaaccgtcaccgtgcataagccc
aaagctccgatcaccgtgccgttcgccgacgtgagcgtcaccatcgagcgatggcggagc
ggacggaatacggacggcaaaactggtcgagctgatgaaggccgtgtcacgcccatgcac
cacgccgtgatcgcactcggcggcaacaagggcgacgtcgcggcgtcgatgcggtccgcg
atcgcggatatcgacggccttgaaggcacacaggtgactgggatatcgccgttgtaccgc
accgccgcatggggcatgccggatggtaccccggattttctcaacgctgtcatcgaggtc
acgaccgagctggacgcggcgagtctgcttggccgcctgcagcatatcgaagttgctcat
ggacgcacgcgggaacaacattgggcgtcgcgcacactggatcttgacatcatcgatgtc
gatggcctcgtcagcgaggacccgaatgtgactttgccgcatccgcgtgcgtggcagcgg
gcgttcgttttggcaccgtggctggctcttgatccggccgcccggctcgcgggcccgcac
gggggagagattgccgatttgctgcacgaggccggtgaccgcgaggacgtacatcgcatc
gacgacagttggatgaccggcatggccgacgatgccccggtgcagccgtccggcagcgca
gccgacataccgcaattcgatggaaccgtcgacggttcggcgcggaaaccgggcgacggc
gataccgctaccgttcaaccggccatacatacggccgtcatctcgatggacagtcgcagt
aacgaggccgaaaccctgttccgcacggcgattgtcgcattggagggcattcccggtgat
caggtcgagggcatctcaccgctgtatcatgtgagccatctgcatgggtcggatgccatg
tcggctgtcatgcaaatgacgtgccggatggacgcgaaggcgctgattgccacgctcggt
tccgtcgaggagtcgttgaacggggatgtcgacctcgatctggtggatatgccgggaacg
gtctgcgatgagccggactgccgggtgccgtggccgtcagcccgcacccatgcttcggtg
ctcgcaccgtggatggacatggacccgcaggcgcggctcggcggcgacccggtgtcgtat
ctgctggccatggcacccgacgccgaccgtgtgggactgctgtccgacacttggatcgta
gggagtacggaatga

DBGET integrated database retrieval system