KEGG   Bifidobacterium bifidum PRL2010: BBPR_1460Help
Entry
BBPR_1460         CDS       T01340                                 

Gene name
lacZ6
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BBPR_1460 (lacZ6)
  Lipid metabolism
   00600 Sphingolipid metabolism
    BBPR_1460 (lacZ6)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BBPR_1460 (lacZ6)
Enzymes [BR:bbp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BBPR_1460 (lacZ6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1722315..1725473
Genome map
AA seq 1052 aa AA seqDB search
MNTTDDQRKNGDPIVSPSIPTTAWLADPRVYAVHRLDAHSDHACWSRSPVDGEGTDLRQS
LDGEWRVRVETAPTGRFPDGTSDGPDWISDVSPLFAAPGFDDSSFSRVQVPSHLETAGLL
APQYVNVQYPWDGHEDPKAPAIPEHGHVAVYRREFDADGEVAQAVREGRPVTLTFQGAAT
AIYVWLNGSFIGYAEDSFTPSEFDVTDAIKVDGNVLAVACYEYSSASWLEDQDFWRLHGL
FRSVELNARPAAHVADLHADADWDLATSRGSLSLDVLIDGAANAATADFALWDKNGTIVW
HIVTKADGTLHAEAEIDDAAPWSAERPDLYELSVTLLDADGKVLETARTRIGFRHVAIED
GILKLNGKRLVFRGVNRHEFDCRRGRAITEEDMLWDIRFMKRHNINAVRTSHYPNQSRWY
ELCDEYGIYLIDETNLETHGSWNSPGDIPVGTSVPGDDEAWLGACIDRLDSMILRDRNHP
SVLVWSLGNESYAGEVLKAMSAHAHRLDPGRPVHYEGVNWNHAYDGISDFESRMYAKPAE
IQDWLEHGDERGEASKPFVSCEYMHAMGNSCGGLSEFIDLERYERYSGGFIWDYIDQGLV
QRLPDGSERLSVGGEWGDRPTDYEFVGNGIVFADRTPSPKAQEVKQLYSPVKLAPDGHGV
TIENRNLFAGTDGYVFAARLLEDGHEIWHADYRFDVAAGDTQHHDIAFPDIDADGDTREV
TYEVDLLLAEATAWAPAGYELAFGQLTGTLNPEQDITETSHDDDGRATRTLSRWNAGIRR
DDEEILLSRTQGGIVSWKRDDREMVIRRPELVTFRPLTDNDRGNHSGFDRAAWFAAGRYA
IVTETKIHESDDGLVAEYQYELADPNHTPVSVTYHVNSDMRMQLTVEYPGNATDMASLPA
FGIEWELPGEYDRLRYYGPGPEETYRDRKQGGKLGIWDATAKASMAPYLMVQETGSHEDV
RWLEATDIQGHGLRVTQRGDRHFTASLLPWNTYTIEAARRHEDLPKPRHNYLRLLAAQMG
VGGDDSWGAPVHTAYQLPAGRPLTLDVNLELI
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaccgacgatcagcggaagaacggcgatccgatcgtctccccgtccataccg
acgacggcatggctcgccgacccgcgcgtgtacgcggttcaccggctcgacgcccattcc
gatcatgcgtgctggtctcgctccccagtcgacggcgagggcacggatctcaggcagagc
cttgacggcgaatggcgggtccgcgtcgagacggcgccgacgggccgtttccccgatggg
acgagcgacgggccggactggatcagcgacgtgtcgcctctgttcgccgcgcccggattc
gacgattcgtcgttctcacgcgtgcaggtgccctcgcatctggagactgcggggctgctt
gccccgcagtacgtgaacgtgcagtacccgtgggacggacatgaggacccgaaggcccca
gccatccccgagcacggccatgtggcggtctaccggcgcgagttcgacgcagatggcgaa
gtcgcccaggccgtgcgcgaagggcgcccggtgacgcttaccttccagggcgcggccaca
gccatctacgtgtggctcaacggctcgttcattggctacgccgaggactccttcacaccc
agcgagttcgacgtgacggacgcgatcaaggtggacggcaacgtgctggcggtcgcctgc
tacgagtattcgagcgcgagctggttggaggatcaggacttctggcgtctgcacggcctg
ttccgctccgtcgaactcaacgcgaggcccgccgcccacgtcgccgacctccatgccgac
gccgactgggatctcgccacatcaaggggttcgctctcgctggatgtgctgatcgacggt
gccgcgaacgccgcgacggccgacttcgcactatgggacaagaacggcaccatcgtctgg
cacatcgtcacgaaagcggacggaacgctgcacgccgaggccgagatcgatgacgcggca
ccatggagcgctgaacgccccgacctgtacgagctatccgtcaccctgctcgacgcggac
ggcaaggtcctggagaccgctcgcactcgcatcggcttccggcatgtggccatcgaggac
ggcatcctcaagctcaacggcaagcgcctcgtgttccgcggcgtcaaccgccacgagttc
gactgccggcgcggccgggccatcaccgaagaggacatgctgtgggacatccgcttcatg
aagcgccacaacatcaacgcggtgcgcacctcgcactatccgaaccagtcacgctggtac
gaactgtgcgacgaatacggcatctacctgatcgacgagaccaatctggagacccatggc
agctggaacagccccggcgacatccccgtgggaacctccgtccccggtgacgacgaggcc
tggctgggcgcgtgcatcgaccggctggacagcatgatcctgcgcgaccgcaaccatccc
agcgtgctcgtctggtcgctgggcaacgaatcctacgcgggcgaagtcctcaaggccatg
agcgcgcacgcgcaccggcttgatccgggtcgtcccgtccactacgaaggtgtcaactgg
aaccatgcctacgacgggatcagcgacttcgaaagccgtatgtacgccaagccggccgag
atccaagactggctcgaacacggcgacgaacggggcgaggcgagcaagccgttcgtcagc
tgtgagtacatgcatgccatgggcaactcgtgcggcggtctgagcgagttcatcgacctc
gaacggtacgagcgctactccggcgggttcatctgggattacatcgaccaggggctcgtc
cagcgtctgcccgacgggagcgaacgcctcagcgtcggcggagaatggggcgaccgtcca
accgactacgaattcgtgggcaacggcatcgtgttcgccgaccgcacgcccagccccaag
gcgcaggaggtcaagcagctgtattcgccggtcaagctcgcccccgacgggcacggcgtg
accatcgagaaccgcaacctgttcgccggcaccgacggctacgtgttcgccgcacggctc
ctcgaagacgggcatgagatctggcatgccgactaccgtttcgacgtggccgcaggagat
acccaacaccatgacatcgccttcccggacatcgacgcggacggggatacgcgcgaagtc
acctacgaggtcgatctcctgctcgccgaagccaccgcatgggcgccggccggctacgag
ctcgcgttcggccaactcaccggcacgctcaaccccgaacaggacatcaccgagaccagc
catgacgacgacggccgcgcaactcgcacgctcagccgatggaacgccggcatccgccgc
gacgacgaggaaattctcctgtcacgcactcagggaggcatcgtctcctggaagcgcgac
gaccgggaaatggtcatccgtcgccccgaactcgtcacgttccgcccattgaccgacaac
gatcgcggtaaccattccggtttcgaccgtgccgcatggttcgcggccggccgatacgcc
atcgtaaccgaaacgaaaatccatgaaagcgatgacggtctcgtagcggaataccagtac
gagcttgccgatccgaaccacacgcccgtgtccgtcacttaccatgtcaactccgatatg
cgtatgcaactgaccgtcgaataccccgggaacgccactgacatggccagtctgcccgcg
ttcggtatcgaatgggagctgcccggcgaatacgatcgtctgcgctactacggccccggc
cccgaggagacctaccgcgaccgtaagcagggcggcaagctcggcatctgggacgccacc
gcgaaggcgagcatggcgccgtatctcatggtgcaggaaaccggcagccacgaggacgtc
cgctggctcgaagccaccgacatccaaggccacggattgcgcgtcacccaacgcggcgac
cgtcacttcacggccagcctgctgccctggaacacctacacgatcgaggccgcacgccgc
cacgaggacctgcccaaaccgcgccacaactacctgcgcctgctcgcggcccagatgggc
gtcggcggagacgactcctggggagcccccgtccacacggcctaccagctgcccgccggc
aggccgctcaccctcgacgtgaacctcgaactcatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system