KEGG   Bifidobacterium bifidum PRL2010: BBPR_1529Help
Entry
BBPR_1529         CDS       T01340                                 

Gene name
nagZ
Definition
beta-n-acetylhexosaminidase NagZ (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BBPR_1529 (nagZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BBPR_1529 (nagZ)
Enzymes [BR:bbp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BBPR_1529 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1819373..1824193
Genome map
AA seq 1606 aa AA seqDB search
MSLTGVTAAQASDDNLALNQTVTASSYEVATTAPEKAVDGDLGTRWGTAQNKAANEWIEV
GLGGTKTVKQINIDFERKDADQNITSFKVELKQGDTYTKVYQKDTRAKQQEIILLDQAQQ
ASAVKVTVLSADGGTMNWVNVGINEISVYSAPKETVLDTADTNHMLGATMTASSNETATL
TPDKAIDQNRTGRNNRWASGYETPSNIWLKAEFPRLTAVKDIRIYFFERDVNPKPTNVQS
FDLSYTDSEGTEHTLKSGYAMTASGTGYVADVVIQLDQAVNARSLKLSNFAIKSSEYNNV
SVAEWEAYSNDQAEPGATLDSVVSDLESNHLTIETDTDTLALPTVPDGYTVKFNGADYEQ
LIAADGTVNHPLVDKTVQVAYVVTDTATGNTKTTSDIPYVVKGTNQQQEGNNAKPTIIPE
IAEWHSTSAAKLAASAVTKVVYDDDSLKAVVDEFVADYKDFTGIKLTAKKGAAEAGAFNF
VKTDSTAAIAQLGDEGYTMNIQADRVVAKSSSVTGNMYAMQTILQMTKQDASGFVIGSMR
DYPRFTTRGLLLDVARKPVSLEMMREITRTMRYYKMNDFQAHLSDNYIFLENYGKRDNED
EAFKAYDAFRLESSLTNDKGESPTAEDYSISKKTFKQFIQDERALGMNVVPEIDVPAHAN
SFTKIWPELMVKGRVSPINSNRPLIDHLDVSKPETIAKIKEIFDDYTKGDDPTFDSDTTV
HIGADEFLYNYTAYRKFINEIVPYIKDTNTVRMWGGLTWINDHKTEITKDAIENVEMNLW
SKDWADGLQMYNMGYKLINTIDDYGYMVPNGSYGRANAYGDLLNISRVFDSFEPNKVRSS
GGYQAVPSGDDQMLGAAFAIWSDNIDKSASGLTESDLYWRFFDAMPFYAEKTWAATGKEK
GTAAKLTALAAKQGTGPRTNPYYQATSKNSVYESYDFNDGLADASGNGRDLTIGDGSKAA
VKDQSLKLAGGSSYATSKLDKLGNGNELTFDVTLQQAAKPGDILFEADAPYGTHDIRVME
NGKLGFTRELYNYYFDYELPVGKTVTVTIKVDQQTTKLYVDGEFVSDATGKYIDKGIEKK
TGITAATFALPLQRIGSKTSAINGVIDNVIVKKSEAETDQYNKSCWTGTTNSETQYNDTE
GLLRYAFDNNPSTIWHSNWKGATDKLTGSNSFYAEIDMCQKYTINQFSFTPRTSQDSGQV
TKADLYVKANANDEWKQVATDQVFEASRAKKTFMFDEQEVRYVKFVAKSSNDGWVAVSEF
GVANKPSSTVRVFVAAEPAEGGTVSVAAEGETGTDTAVDVASGASVTAKAVAADGYRFSG
WFTTASETAVSTDATYTFAADGNTALTAKFTKDSTPDPGPKPTISSIAVTKPTVTDYKVG
DTFDATGLAVTATMSDGSTKTLTAGEYTLAATQDGAAVALDEAFAKAGKVTVTVTANGKT
ATFDVTVTAKDPDPEPATLKSIKVTSRPDKATYTVDETFAKTGLAVTGTWSDGKTALLKD
GEYKLSAVDADGKTVDLTKPFTAAGDVTVTVTSGKLTDSFTITVKAKTVTPTPGDNKPGE
NKPGADKPKPNTPDEVAKTGASVTAVVFSALLLLSAGYLLVRKRRI
NT seq 4821 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgaccggcgtcacggcggcgcaagccagcgatgacaatcttgcactgaatcag
accgtaacggccagttcatatgaagtggcgacgactgcgcccgagaaggccgtggacggc
gatctcggcacacgctggggcaccgcgcagaacaaggccgcaaacgaatggatcgaggtc
ggcttgggcggcaccaagaccgtcaagcagatcaacatcgatttcgagcgcaaagatgcc
gatcagaacatcaccagttttaaagtcgagctgaagcagggcgacacctataccaaggtg
tatcagaaggacacccgcgccaagcaacaggagatcatcctgcttgaccaggcacagcag
gcgtccgccgtgaaggtgaccgtactgtccgccgacggcggcaccatgaactgggtcaac
gtgggcatcaacgagatttccgtgtactccgcacccaaggagaccgtgctcgacacggcc
gacacgaaccacatgctcggcgccaccatgaccgcctccagcaacgagacggcgacgctc
acccccgacaaggcgatcgaccagaaccgcaccggccgcaacaaccgttgggccagcggc
tacgagaccccgagcaacatctggctgaaggcggaattcccgcggctcaccgcggtcaag
gacatccgcatctatttcttcgagcgtgacgtgaatccgaagcctaccaatgtccagagc
ttcgacctgtcctacaccgactccgaaggcaccgagcacacgctcaagtccggctacgcg
atgacggcctccgggaccggttatgtcgctgacgtcgtcatccagctcgatcaggccgtc
aacgcccgctcgctcaagctgtcgaacttcgcgatcaaaagctccgaatacaacaacgtg
agcgtcgccgaatgggaggcgtattcgaacgatcaggccgagccgggcgccacgctcgac
agcgtggtctccgacctcgaatccaaccacctgaccatcgagaccgacaccgacacgctg
gctctgcccactgtgcccgacggctacaccgtcaagttcaacggcgccgactacgagcag
ctcatcgccgccgacggcaccgtcaaccacccgctggtcgacaagaccgtgcaggtcgcc
tacgtcgtcaccgacaccgccaccggcaacaccaagacgacctccgacatcccctacgtc
gtcaaaggcaccaaccagcagcaggaaggcaacaacgccaagccgaccatcatccccgaa
atcgccgaatggcattcgaccagtgccgccaagctggcggcctccgccgtgacgaaggtc
gtctacgacgatgattcgctcaaggccgtggtcgacgagttcgtcgccgactacaaggac
ttcaccggcatcaagctgaccgccaagaagggcgccgccgaagccggtgcgttcaacttc
gtcaagaccgactccacggccgcgatcgcgcagctcggcgacgaaggctacacgatgaac
atccaggccgaccgcgtggtcgccaagtcatccagcgtgaccggcaacatgtacgcgatg
cagacgatcctgcagatgaccaagcaggacgccagcggcttcgtgatcggttcgatgcgc
gactacccgcgcttcaccacccgcggactcctgctcgacgtggcccgcaagcccgtctcg
ctggagatgatgcgcgagatcacccgcacgatgcgctactacaagatgaacgacttccag
gcgcatctgtccgacaactacatcttcctggagaactacggcaagcgcgacaacgaggac
gaggcgttcaaggcctatgacgcgttccgtctcgaatccagcctgaccaacgacaagggc
gaatcgcccacggccgaggactactccatctccaagaagacgttcaagcagttcatccag
gacgagcgcgccctcggcatgaacgtcgtgccggagatcgacgtgcccgcgcacgccaac
tccttcacgaagatctggcccgagctcatggtgaagggacgggtctccccgatcaactcc
aaccgaccgctcatcgaccacctcgacgtgtccaagcccgagaccatcgccaagatcaag
gagatcttcgacgactacaccaagggcgacgacccgacgttcgacagcgacacgaccgtg
cacatcggtgccgacgagttcctctacaactacacggcataccgtaagttcatcaacgag
atcgtcccctacatcaaggacacgaacaccgtgcgcatgtggggcggcctgacttggatc
aacgaccacaagacggagatcaccaaggacgcgatcgagaacgtcgagatgaacctgtgg
tccaaggactgggccgacggcctccagatgtacaacatgggctacaagctgatcaacacg
atcgacgactacggctacatggtgcccaacggcagctacggacgtgccaacgcgtacggc
gacctgctgaacatcagccgcgtcttcgacagcttcgagcccaacaaggtccgcagcagc
ggcggctaccaggccgtgccctccggcgacgaccagatgctcggcgccgcgttcgcgatc
tggagcgacaacatcgacaagagcgcatcgggtctgaccgaatccgacctgtactggcgc
ttcttcgacgcgatgccgttctacgccgagaagacctgggccgccaccggcaaggagaag
ggcaccgccgcgaaactcacggcgctggccgccaagcagggaaccggccctcgcaccaac
ccgtactaccaggccacttcgaagaacagcgtctacgagagctacgacttcaacgacggg
ctcgccgacgccagcggcaacggccgcgacctgaccatcggcgacggcagcaaggccgcc
gtcaaggaccagtcgctcaagctcgccggcggctccagctatgccacatccaagctcgac
aagctcggcaacggcaacgagctgacgttcgacgtgacgctccagcaggctgccaagccc
ggagacatcctcttcgaggccgacgctccgtacggcacgcatgacatccgcgtcatggag
aacggcaagctcggcttcacgcgagagctgtacaactactacttcgattacgagctgccg
gtcggcaagacggtcaccgtgaccatcaaggtggaccagcagaccacgaagctgtatgtt
gacggcgaattcgtgagcgatgcgaccggcaagtacatcgacaagggcatcgagaagaag
accggcatcactgctgcgaccttcgcactgccgctgcagcgtatcggctcgaagacctct
gcgatcaacggcgtcatcgacaacgtcatcgtcaagaagtccgaggccgagacagaccag
tacaacaagtcctgctggaccggcacgaccaattccgagacccaatacaacgacacggaa
ggtctgctgcggtacgcgttcgacaacaacccgagcaccatctggcattccaactggaag
ggcgccacggacaagctgaccggttcgaactcgttctacgccgagatcgacatgtgccag
aagtacacgatcaaccagttctccttcacgccgcgtaccagccaggacagcggacaggtg
accaaggccgatctgtacgtcaaggccaacgcgaacgacgagtggaagcaggtcgccacg
gatcaggtgttcgaggccagccgcgccaagaagaccttcatgttcgacgagcaggaagtg
cggtacgtcaagttcgtggccaagtcctcgaacgatggctgggtcgcggtctccgagttc
ggcgtggcgaacaagccgtcctccaccgtgcgcgtattcgtcgcggccgaaccggccgaa
ggcggtacggtgagcgtagccgccgagggcgaaaccggcaccgatacggccgtggacgtc
gcatccggcgcctcggtgaccgccaaggcggtcgcggcggatggctacaggttcagcggc
tggttcacgacggccagtgagacggcggtttccaccgatgccacgtacacgttcgcagcc
gacggcaacacggctctgaccgcgaagttcaccaaggactccacgccggatcccggcccg
aagccgaccatcagctcgatcgccgtcaccaagccgaccgtcaccgattacaaggtcggc
gacacgttcgacgccactggactggcggtcaccgccacgatgtcggacggcagcacgaag
accctgacagccggcgagtacacgctcgcagccacgcaggacggtgccgcggtcgcgctt
gacgaggcgttcgccaaggccggaaaggtcactgtcacggtcaccgccaacggcaagacc
gccaccttcgacgtgaccgtgacggccaaggatcccgatccggaacccgcgacgctcaag
tccatcaaggtcacgtccaggccggacaaggccacgtacaccgtggatgagacgttcgcc
aagaccggtctcgcggtgacgggcacctggtccgacggcaagacggcgctgctgaaggac
ggcgaatacaagctgtccgcggtcgacgccgacggcaagaccgtcgacttgaccaagccg
ttcacggccgcgggcgacgtcaccgtcacagtgacctccggcaagctcaccgactccttc
acgatcaccgtcaaggcaaagaccgtgaccccgactcctggcgacaacaagccgggcgag
aacaagcccggtgccgacaagccgaagccgaacacgcctgacgaggtcgccaagaccggt
gcttcggtcacggcggtcgtcttcagcgccctgttgctgttgtccgcaggctacctgctg
gtgcgtaagcgcaggatctga

DBGET integrated database retrieval system