KEGG   Blattabacterium sp. (Blatta orientalis): BLBBOR_496Help
Entry
BLBBOR_496        CDS       T02446                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bbq  Blattabacterium sp. (Blatta orientalis)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bbq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLBBOR_496
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLBBOR_496
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BLBBOR_496
Enzymes [BR:bbq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BLBBOR_496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(504945..506255)
Genome map
AA seq 436 aa AA seqDB search
MLYYSLEDHKKLVSFDKAVLRGLAIDGGLYFPEYIPILKRKFLENLQKYDIYTIAMEVIQ
PYIGKSISEESILRIIQKTLNFPFPLQRIHDNIYALELFHGPTLAFKDVGAKFMAGCLSH
FYKKIGKLVTVLVATSGDTGGAVAKGFHNVSGIEVIILYPYKGVSLLQEKQMTCLGGNIL
AIEIKGNFDDCQSMVKKAFLDNKIRDKYLLTSANSINIARWLPQMFYYFLAYRKIIEENR
KLIFSVPSGNFGNICAGMMAEKMGLPIKYFIASTNINDTIPRFLKTEKYHPLPVKKTISN
AMDISHPSNFSRIWHLYKESIVQLRKKLSSYQFTDEETLAIIEMVWKEHKYMLDPHGAIG
YLGLIQYLQEIKDPLATAVFLETAHPIKFLDHMPYSLREEILIPKKLEVLLNSEKSEKKI
SMSNNYDMFQNWLINR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgttatattacagtttagaagatcataaaaaactagtttcttttgataaggcagtttta
agaggtttagcaatagatggagggctatattttccggaatatattcctattctaaaacgt
aagttcctggaaaatctccaaaaatatgatatatacactattgctatggaggttattcaa
ccatatataggaaaatctatttctgaagaatctatcttacgtattattcagaaaactttg
aatttcccttttccattacaaagaattcacgacaatatatacgcgttagagctttttcat
gggccgactttagcctttaaagacgtaggggctaaatttatggccggatgtttaagtcat
ttttacaaaaaaatagggaaattagttactgttttagtagccacttctggagatactgga
ggggcggttgccaaaggatttcataatgtttctggaatagaggttatcatattatatccc
tataaaggggtaagcttattgcaggaaaagcaaatgacttgtttaggggggaatattcta
gctatagaaataaagggaaattttgatgattgccaatccatggttaaaaaagctttctta
gacaataaaatacgagataaatatctactaacttctgctaattctattaacatagcaaga
tggcttcctcaaatgttttattattttttagcttatagaaaaataatagaagaaaataga
aaattgattttttcagttccaagtggaaattttgggaatatttgtgcgggaatgatggct
gaaaaaatgggattgcctattaagtattttatagcatccacaaatattaatgacaccatt
cctagatttttaaaaacggaaaaatatcatcctcttccagtaaaaaaaacgatatcaaat
gccatggacatatcccatccgagtaatttttctcggatatggcatttatataaagaaagc
atagtgcaattacgaaaaaaattgtcctcttatcaatttacagatgaagaaactttagcc
attatagaaatggtatggaaagaacataaatatatgctagatccccatggagctattggt
tatttaggacttatacaatacctacaagagattaaagatcctttagctacagctgttttt
ttagaaacagctcatcctattaaatttttagatcatatgccatattctttgcgagaagaa
attcttattcctaaaaaattagaagttcttttgaattcagaaaaaagtgaaaaaaaaata
tcgatgtccaacaattacgatatgtttcaaaattggttaattaatagatag

DBGET integrated database retrieval system