KEGG   Bordetella bronchiseptica RB50: BB0063Help
Entry
BB0063            CDS       T00141                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bbr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(55484..56500)
Genome map
AA seq 338 aa AA seqDB search
MKPQIISAAFPVSRPRRLRRDDFTRRLVRENTLTANDLIYPVFVTEGKGIQQAVPSLPGV
VRYSLDTLLPVAEQCVKLGIPVLSLFPAIEPALKTPDGIEAANPEGLIPRVVGELKKRFP
ELGVLTDVALDPYTSHGQDGVIDPAGYVLNEPTVEILIKQALVQAAAGVDIVAPSDMMDG
RIGAIRQALEDQQHIHTRIMAYSAKYASAFYGPFRDAVGSASNLGKSDKMAYQMDPGNID
EALREVAADLQEGADMVMVKPGMPYLDVVRRVKDAFRVPTFAYQVSGEYAMIKAAAANGW
LDHDKVMMEALLGFKRAGADGVLTYFALEAATLLQQQR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgcagatcatttccgccgcattcccggtatcccgcccccgccgcctgcgccgc
gacgatttcacgcgccgcctggtacgcgagaacacgctcaccgccaacgatctgatttac
ccggtcttcgtgaccgaaggcaaaggcatacagcaggccgtgccctcgctgcccggcgtg
gtgcgctactcgctcgacacgctgctgcccgtggccgagcaatgcgtcaagctgggcatc
ccggtgctgtcgctgtttccggccatcgagccggccctcaagacgcccgacggcatcgag
gcggccaatcccgaaggcctgatcccgcgcgtggtgggcgagctgaaaaagcgctttccc
gaactcggcgtgctcaccgacgtcgccctcgacccgtataccagccacgggcaggatggc
gtgatcgaccccgccggctacgtgctgaacgagcccaccgtcgaaatcctcatcaagcag
gccctggtgcaggccgccgccggtgtggacatcgtcgcgcccagcgacatgatggacggc
cgcatcggcgcgatacgccaggcgctggaagaccagcagcatatccacacccgcatcatg
gcctattcggccaagtacgccagcgccttctacggcccgttccgcgacgcggtcggctcg
gccagcaacctgggcaagtccgacaaaatggcttaccagatggacccgggcaacatcgac
gaagcgctgcgcgaagtcgccgccgacctgcaggaaggcgcggacatggtgatggtcaag
cccggcatgccctacctggacgtggtgcgccgggtcaaggacgcgttccgcgtgccgacc
ttcgcctaccaggtcagcggcgaatacgccatgatcaaggccgccgccgccaatggctgg
ctcgaccacgacaaggtcatgatggaggccttgctcggcttcaagcgtgccggcgccgac
ggcgtgctgacctacttcgccctcgaggccgccacgctgctgcagcagcagcgctag

DBGET integrated database retrieval system