KEGG   Bordetella bronchiseptica RB50: BB0095Help
Entry
BB0095            CDS       T00141                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bbr01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bbr00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bbr00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(92468..94645)
Genome map
AA seq 725 aa AA seqDB search
MTERIPHHGLQVAASLHRFIEDEALSGSGLAPDEFWAGFAALVRDLAPRNRELLAERDRL
QGEIDAWHRAHPGPVRDSAGYQALLERIGYLQPQPAQVTASTRDVDSEIASQAGPQLVVP
VSNARYALNAANARWGSLYDALYGTDAIPPVAGDDGKGYNPARGEAVIARARAFLDEAAP
LAQGSHADATAYAIEGGKLAVTLGAGQRTGLRNPAQLAGYQGDASQPAAVLLANNGLHFE
IQIDRQHQIGATDAAGVKDVLLEAALTTIMDCEDSVAAVDADDKVLIYRNWLGLMKGDLS
ESVTKGGKTFTRRLNADRQYHKPDGGTLTLHGRSLMFVRNVGHLMTNPAILDEQGNEVPE
GILDAVITSLAALPDRANRLNSRTGSIYIVKPKMHGPAEAAFANELFDRVEDLLKLPRHT
IKMGIMDEERRTSVNLKACIAAAAARVAFINTGFLDRTGDEMHTGMEAGPMLRKGDMKSS
AWITAYERNNVLVGLDCGLRGRAQIGKGMWAMPDMMAAMLEQKIGHPKAGANTAWVPSPT
AATLHAMHYHQVDVAAVQQALEQTRYDSVRDELLAGLLTVPVGDPAAWSADDIQRELDNN
AQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLRHGIVDRAQVNAT
FERMAKVVDQQNAGDPNYLPMAGHFDTSFAYRAACALVFEGLTQPNGYTEPLLHEYRQAF
KAAQR
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacgcatcccgcatcatggcctgcaagtggcggcctccctgcaccgtttcatc
gaagacgaggcgttgtccggcagcggcctggcgcccgacgagttctgggccggcttcgcc
gccctggtgcgcgacctcgcgccgcgcaaccgagaactgctggccgagcgcgaccgcctg
cagggcgaaatcgacgcctggcaccgcgcccatcccggccccgtgcgcgacagcgccggg
tatcaggcgctgctcgaacgcatcggctacctgcagccccagccagcacaggtgaccgcc
agtacccgcgacgtggacagcgagatcgccagccaggccggcccgcagctggtggttccc
gtctccaacgcgcgctatgcgctgaacgcggccaacgcccgctggggcagcctgtacgac
gcgctctatggcaccgacgcgatcccgccggtggccggcgatgacggcaagggctacaac
ccggcgcgcggcgaagccgtgatcgcccgcgcgcgcgccttcctggacgaggcggcgccg
ctggcccagggttcgcacgccgacgccaccgcctacgccatcgagggtggcaagctggcg
gtcacgctgggcgccggccagcgcacgggcctgcgcaaccccgcgcaactggccggctat
cagggcgacgcctcgcaaccggccgccgtgctgctggccaacaacggcctgcacttcgaa
atccagatcgaccgccagcaccagatcggcgccaccgatgccgccggcgtcaaggacgtg
ctgctcgaggccgccctgaccaccatcatggattgcgaagactccgtggcggccgtcgat
gccgacgacaaggtactgatctaccgcaactggctcgggctcatgaagggcgacctgagc
gaatcggtcaccaagggcggcaagaccttcacccgccgcctgaacgccgaccgccagtac
cacaagcccgacggcggcaccctgacgctgcacggccgctcgttgatgttcgtgcgcaac
gtcggccacctgatgaccaacccggccatcctcgacgagcaaggcaatgaagtgccggaa
ggcatcctggatgcggtgatcaccagcctggccgccctgcccgaccgcgccaaccggctc
aactcgcgcaccggctcgatctacatcgtcaagcccaagatgcacggaccggccgaggcc
gccttcgccaacgagttgttcgaccgcgtcgaggacctgctcaagctgccgcgccacacc
atcaagatgggcatcatggacgaagagcggcgcaccagcgtcaacctgaaggcctgcatc
gcggccgcggcggcgcgcgtggctttcatcaacaccgggttcctggaccgcaccggcgac
gaaatgcataccggcatggaagccggcccgatgctgcgcaagggcgatatgaaatccagc
gcctggatcaccgcctacgagcgcaacaacgtgctggtcgggctggactgcggcctgcgc
gggcgcgcccagatcggcaagggcatgtgggccatgcccgacatgatggcggccatgctc
gaacagaagatcggccaccccaaggcgggcgccaacacggcctgggtgccctcgcccacg
gccgcgaccctgcacgccatgcactatcaccaggtcgacgtcgcggccgtgcagcaggcg
ctggagcagacccgctacgacagcgtgcgcgacgagctgctggccggcctgctgaccgtc
ccggtaggcgatccggccgcctggtcggccgatgacatccagcgcgagctcgacaacaac
gcccagggcatcctgggctacgtggtgcgctggatcgaccagggcgtgggatgctcgaag
gtgcccgacatcaacaacgtcggcctgatggaagaccgcgccaccctgcgcatctccagc
cagcacatcgccaactggctgcgccacggcatcgtcgaccgcgcacaggtcaacgccacg
ttcgaacgcatggccaaggtcgtcgaccagcaaaacgccggcgatcccaactacctgccc
atggccggccacttcgacacctcgttcgcctaccgcgcggcgtgcgcgttggtcttcgag
ggcctgacccagcccaacggctacaccgagcccctgctgcacgagtaccggcaagccttc
aaggcggcccagcgctga

DBGET integrated database retrieval system