KEGG   Bordetella bronchiseptica RB50: BB0298Help
Entry
BB0298            CDS       T00141                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00010  Glycolysis / Gluconeogenesis
bbr00260  Glycine, serine and threonine metabolism
bbr00680  Methane metabolism
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01120  Microbial metabolism in diverse environments
bbr01130  Biosynthesis of antibiotics
bbr01200  Carbon metabolism
bbr01230  Biosynthesis of amino acids
Module
bbr_M00002  Glycolysis, core module involving three-carbon compounds
bbr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BB0298 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BB0298 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BB0298 (gpmA)
Enzymes [BR:bbr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BB0298 (gpmA)
Membrane trafficking [BR:bbr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BB0298 (gpmA)
Exosome [BR:bbr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BB0298 (gpmA)
  Exosomal proteins of melanoma cells
   BB0298 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAE30796
GeneDB: BB0298
UniProt: Q7WQN2
Position
300237..300989
Genome map
AA seq 250 aa AA seqDB search
MYKLVLMRHGESQWNLENRFTGWTDVDLTETGREQARKAGELLKREGYAFDLAYTSVLKR
AIRTLWIALDAMDAMYTPVGINWRLNERHYGQLQGLNKAETAAKYGDEQVLIWRRAYAIA
PEPLDLEDPRHPRFDGRYAKIPADQLPATECLKDTVARVLPFWNESIAPAIRAGRRVLVA
AHGNSLRALIKHLDNVSDDDIVGVNIPTGQPLVYELDEDLKPIRHYYLGDAAEIEAAMAA
VAAQGKAKKD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaacttgttctgatgcgccacggcgaaagccagtggaacctggaaaaccgtttc
acgggctggaccgatgtggacctgaccgaaaccggccgcgagcaggcccgcaaggcgggc
gaattgctcaagcgcgagggctacgccttcgacctggcctatacctcggtgctcaagcgc
gctatccgtacgctctggatcgccctggacgccatggacgccatgtataccccggtgggc
atcaactggcgcctgaacgagcgccactacggccagctgcaaggcctgaacaaggccgag
accgccgccaagtacggcgacgagcaggtgctgatctggcgccgcgcctacgcgatcgcc
ccggagccgctggacctggaagatccgcgccacccgcgtttcgatggccgctacgccaag
attccggccgaccagctgccggccaccgaatgcctgaaggatacggtggcgcgcgtgctg
ccgttctggaacgaatcgatcgccccggccatccgcgccggccgccgcgtcctggtggcc
gcgcatggcaacagcctgcgcgcgctgatcaagcacctcgacaatgtttccgatgatgac
atcgtgggcgtgaatattccgaccggccagcctctggtgtatgaattggatgaggacctg
aagccgattcgccactattatctgggcgatgccgccgagatcgaggcggcgatggctgcc
gtggcggcgcagggcaaggcgaaaaaggactga

DBGET integrated database retrieval system