KEGG   Bordetella bronchiseptica RB50: BB0342Help
Entry
BB0342            CDS       T00141                                 

Definition
Zinc-binding dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BB0342
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BB0342
  Lipid metabolism
   00071 Fatty acid degradation
    BB0342
  Amino acid metabolism
   00350 Tyrosine metabolism
    BB0342
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BB0342
   00626 Naphthalene degradation
    BB0342
Enzymes [BR:bbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BB0342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(353943..354950)
Genome map
AA seq 335 aa AA seqDB search
MKAVVIHGHGGPEVLQYDTAFPDPKAGEGDVILRVKATSINYHDVFTRRGMPGIKLDFPV
IMGLDVAGEIVEVGPGVQGWKAGDRVLVDPINRAEGGLMGETVHGGLAELCKAREHQLIR
IPDGVSYEQAAALPVAFGTAYRMMNTIGQVQAGEKVLVLGASGGVGVGCVMLAKIAGAQV
IACASSEAKMQRLRELGADHVINYADTDFAKAIYELYGKPHRRKFDGGVDVAVNFTGGDT
WVKSMRCLRRGGRLLTCGATAGYDPQTDLRFIWTFELNIRGSNGWMREDLDALLGLVQSG
KMQVPIDRVLSLQDAGEALRLIEDREVMGKVVVTP
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagttgtcattcacggtcacggcggtccggaagtcttgcaatacgacaccgca
tttcccgatccgaaggcgggcgaaggcgacgtgatcctgcgcgtcaaggcaacgtcgatc
aactatcacgatgtatttacccggcgggggatgccaggcatcaagttggactttccggtc
atcatggggctggacgtggccggcgaaatcgtcgaggtcggccccggcgtgcagggctgg
aaggccggcgaccgcgtgctggtcgacccgatcaaccgggccgagggcggcctgatgggc
gagaccgtgcacggcggcctggccgaactgtgcaaggcgcgcgagcaccagctgatccgc
attccggacggcgtcagctacgagcaggcggccgcgctgccggtggctttcggcacggcc
tatcggatgatgaacaccatcggccaggtgcaggccggcgaaaaggtgctggtgctgggc
gccagcggcggcgtgggcgtgggttgcgtgatgctggccaagatcgccggcgcgcaggtg
atcgcctgcgccagcagcgaagccaagatgcagcggctgcgcgaactgggcgccgaccac
gtcatcaactacgccgacaccgatttcgccaaggcgatctatgagctctacggcaagccg
catcgccgcaagttcgacggcggcgtcgacgtggcggtgaacttcaccggcggcgatacc
tgggtcaagtcgatgcgctgcctgcggcgcggcggccgcctgctgacctgcggcgcgacc
gccggctacgatccgcagaccgacctgcgcttcatctggaccttcgagctgaacatccgc
ggctccaacggctggatgcgcgaagacctggacgccctgctcggcctggtgcagtcgggc
aagatgcaggtgccgatcgaccgcgtgctgagcctgcaggatgccggcgaggcgctgcgc
ctgatcgaggaccgcgaagtcatgggcaaggtcgtggtcacgccctga

DBGET integrated database retrieval system