KEGG   Bordetella bronchiseptica RB50: BB0342Help
Entry
BB0342            CDS       T00141                                 

Definition
(GenBank) probable Zinc-binding dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00010  Glycolysis / Gluconeogenesis
bbr00071  Fatty acid degradation
bbr00350  Tyrosine metabolism
bbr00625  Chloroalkane and chloroalkene degradation
bbr00626  Naphthalene degradation
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01120  Microbial metabolism in diverse environments
bbr01130  Biosynthesis of antibiotics
bbr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BB0342
  Lipid metabolism
   00071 Fatty acid degradation
    BB0342
  Amino acid metabolism
   00350 Tyrosine metabolism
    BB0342
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BB0342
   00626 Naphthalene degradation
    BB0342
Enzymes [BR:bbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BB0342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N adh_short AlaDh_PNT_C ACP_syn_III_C THF_DHG_CYH_C PALP TrkA_N Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: CAE30840
GeneDB: BB0342
UniProt: A0A0H3LGX5
Position
complement(353943..354950)
Genome map
AA seq 335 aa AA seqDB search
MKAVVIHGHGGPEVLQYDTAFPDPKAGEGDVILRVKATSINYHDVFTRRGMPGIKLDFPV
IMGLDVAGEIVEVGPGVQGWKAGDRVLVDPINRAEGGLMGETVHGGLAELCKAREHQLIR
IPDGVSYEQAAALPVAFGTAYRMMNTIGQVQAGEKVLVLGASGGVGVGCVMLAKIAGAQV
IACASSEAKMQRLRELGADHVINYADTDFAKAIYELYGKPHRRKFDGGVDVAVNFTGGDT
WVKSMRCLRRGGRLLTCGATAGYDPQTDLRFIWTFELNIRGSNGWMREDLDALLGLVQSG
KMQVPIDRVLSLQDAGEALRLIEDREVMGKVVVTP
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagttgtcattcacggtcacggcggtccggaagtcttgcaatacgacaccgca
tttcccgatccgaaggcgggcgaaggcgacgtgatcctgcgcgtcaaggcaacgtcgatc
aactatcacgatgtatttacccggcgggggatgccaggcatcaagttggactttccggtc
atcatggggctggacgtggccggcgaaatcgtcgaggtcggccccggcgtgcagggctgg
aaggccggcgaccgcgtgctggtcgacccgatcaaccgggccgagggcggcctgatgggc
gagaccgtgcacggcggcctggccgaactgtgcaaggcgcgcgagcaccagctgatccgc
attccggacggcgtcagctacgagcaggcggccgcgctgccggtggctttcggcacggcc
tatcggatgatgaacaccatcggccaggtgcaggccggcgaaaaggtgctggtgctgggc
gccagcggcggcgtgggcgtgggttgcgtgatgctggccaagatcgccggcgcgcaggtg
atcgcctgcgccagcagcgaagccaagatgcagcggctgcgcgaactgggcgccgaccac
gtcatcaactacgccgacaccgatttcgccaaggcgatctatgagctctacggcaagccg
catcgccgcaagttcgacggcggcgtcgacgtggcggtgaacttcaccggcggcgatacc
tgggtcaagtcgatgcgctgcctgcggcgcggcggccgcctgctgacctgcggcgcgacc
gccggctacgatccgcagaccgacctgcgcttcatctggaccttcgagctgaacatccgc
ggctccaacggctggatgcgcgaagacctggacgccctgctcggcctggtgcagtcgggc
aagatgcaggtgccgatcgaccgcgtgctgagcctgcaggatgccggcgaggcgctgcgc
ctgatcgaggaccgcgaagtcatgggcaaggtcgtggtcacgccctga

DBGET integrated database retrieval system