KEGG   Bordetella bronchiseptica RB50: BB0615Help
Entry
BB0615            CDS       T00141                                 

Definition
(GenBank) AMP-binding enzyme
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00010  Glycolysis / Gluconeogenesis
bbr00620  Pyruvate metabolism
bbr00640  Propanoate metabolism
bbr00680  Methane metabolism
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01120  Microbial metabolism in diverse environments
bbr01130  Biosynthesis of antibiotics
bbr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BB0615
   00620 Pyruvate metabolism
    BB0615
   00640 Propanoate metabolism
    BB0615
  Energy metabolism
   00680 Methane metabolism
    BB0615
Enzymes [BR:bbr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BB0615
Lipid biosynthesis proteins [BR:bbr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BB0615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAE31115
GeneDB: BB0615
UniProt: A0A0H3LQN0
Position
647257..649206
Genome map
AA seq 649 aa AA seqDB search
MMHTNDSSHVWQPGQRELQDSGIAHLIRTLGAATYDDLMRVSVEEPERYWNTVMRECAIA
WDEPPTGYVDLARGPQFPSWFPGGRLNWVNTIYAWARNPATAGQTAVIGEREDGSVGSLT
YQELETRVREFAAGLARHGARPGDRIGLLMENGVDATVSLLAIVHLGALVVPLFSGFGVD
AIVARLSAAEARMVIASTGFQRRTKRVDVQGALRDAWRQLPLLENVVWKRADGESAQDQR
DLDWQQIATAAQGQGQDPVSVTPDTPFMVIYTSGTTGKPKGVVHTHGSFPIKIAHDSLVH
FDVHPGDVYCWPADMGWIAGTLVLGCALLRGATLVCYDGAPDYPDWSRMSRVVERHKVTH
FGSAPTLIRGMASNETLALAGDRATVRVLITAGEGIAPEHFIWFQQRFGDGSAPLVNYTG
GTEVSGALLSSVPIRPIPPSGFNTISPGVAVDVVDPDGHSVTGEVGELAVRAPFVGMTQS
FWHDDARYLETYWQAIPGIWVHGDLALRTPEGYFFMMGRSDDTLKVAGKRLGPAEVEEVV
LELHDVAEAAAIGVADAAKGQKLVVFVVPRPGVSVPDDALQAAVIGHVDKRLGRPFRPGR
VHVVSQLPKTRSSKIMRRVIRSVYCGQPPGDLSSLDNPAALDEVRAAAA
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgatgcataccaacgattcctcccatgtctggcagccgggccagcgcgaactgcaggat
tccggcatcgcgcacctgatacgcaccctgggcgccgctacgtacgacgacctcatgcgg
gtgtcggtggaggagcccgagcgctactggaacaccgtgatgcgcgagtgcgcgatcgcg
tgggacgagccgcccacgggctatgtggacctggcgcgcgggccgcagtttcccagctgg
tttcccggcggcaggctgaactgggtcaataccatctacgcctgggccaggaacccggcc
accgcggggcagaccgccgtgatcggcgagcgcgaggacggcagcgtcggttcgctgacc
taccaggaactcgagacccgcgtgcgtgaattcgcggccggcctggcgcggcacggcgcc
aggccgggcgaccgcatcggcctgctgatggaaaacggcgtcgatgccacggtgtccctg
cttgccatcgtgcacctgggcgccctggtcgtgccgctgttcagcggtttcggcgtcgat
gcgatcgtggcccgcctgtcggccgccgaggcgcgcatggtgatcgcgtccaccggcttc
cagcgccgtaccaagcgcgtggacgtgcagggcgcgctgcgcgacgcatggcgccagctg
ccgttgctcgagaacgtggtctggaagcgcgccgacggcgaaagcgcccaggaccagcgg
gacctggactggcagcagatcgccacggccgcgcagggccagggccaggatcccgtgtcg
gtgacgcccgatacgcccttcatggtgatctacacctcgggcaccaccggcaagcccaag
ggcgtcgtgcacacgcacggcagcttcccgatcaagatcgcgcacgattcgctggtccat
ttcgacgtccatcccggcgacgtgtattgctggccggccgacatgggctggatcgccgga
acgctggtgctcggctgcgcattgctgcgcggcgccacgctggtgtgctatgacggcgcg
ccggactatcccgactggtcgcgcatgtcccgggtggtggagcgccacaaggtgacgcac
ttcggctcggcgcccacgctgatccgcggcatggccagcaacgagacgctggcgctggcg
ggcgatcgcgccacggtgcgcgtgctgatcacggcgggcgagggtatcgcgcccgagcat
ttcatctggttccagcagcgcttcggcgacggctcggcgccgctggtcaattacaccgga
ggcaccgaggtgtcgggcgcgctgctctcgagcgtgccgatccgcccgatcccgcccagc
ggcttcaataccatttcgccgggcgtggccgtcgacgtcgtcgatcccgacggccacagc
gtgaccggcgaggtcggcgagctggcggtgcgcgcgcctttcgtgggcatgacccagtcg
ttctggcacgacgacgcgcgctatctcgaaacctactggcaggccatccccggcatctgg
gtgcatggcgacctggccctgcgcacccccgaaggctatttcttcatgatggggcgctcg
gacgacacgctgaaagtcgcgggcaagcgcctgggtccggccgaggtggaggaggtcgtc
ctggaactgcatgacgtggccgaggcggccgccatcggggtggccgacgccgccaagggc
cagaagctggtggtcttcgtcgtgcccaggcccggcgtcagcgtcccggacgacgcgctg
caggccgccgtgatcggccacgtggacaagcgcctgggccgtccgttccggcccggccgg
gtgcacgtggtgagccagttgcccaagacgcgcagttccaagatcatgcggcgcgtcatc
cgcagcgtgtactgcggacagccgccgggcgatctttcttcgttggacaacccggccgcg
ctcgacgaagtgcgtgcggccgcggcctga

DBGET integrated database retrieval system