KEGG   Bordetella bronchiseptica RB50: BB0763Help
Entry
BB0763            CDS       T00141                                 

Definition
(GenBank) enoyl CoA dehydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00071  Fatty acid degradation
bbr00280  Valine, leucine and isoleucine degradation
bbr00281  Geraniol degradation
bbr00310  Lysine degradation
bbr00360  Phenylalanine metabolism
bbr00362  Benzoate degradation
bbr00380  Tryptophan metabolism
bbr00410  beta-Alanine metabolism
bbr00627  Aminobenzoate degradation
bbr00640  Propanoate metabolism
bbr00650  Butanoate metabolism
bbr00903  Limonene and pinene degradation
bbr00930  Caprolactam degradation
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01120  Microbial metabolism in diverse environments
bbr01130  Biosynthesis of antibiotics
bbr01212  Fatty acid metabolism
Module
bbr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BB0763
   00650 Butanoate metabolism
    BB0763
  Lipid metabolism
   00071 Fatty acid degradation
    BB0763
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BB0763
   00310 Lysine degradation
    BB0763
   00360 Phenylalanine metabolism
    BB0763
   00380 Tryptophan metabolism
    BB0763
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BB0763
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BB0763
   00281 Geraniol degradation
    BB0763
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BB0763
   00627 Aminobenzoate degradation
    BB0763
   00930 Caprolactam degradation
    BB0763
Enzymes [BR:bbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BB0763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 UPF0444
Motif
Other DBs
NCBI-ProteinID: CAE31262
GeneDB: BB0763
UniProt: A0A0H3LHY6
Position
796105..796887
Genome map
AA seq 260 aa AA seqDB search
MSVQAPDAAEVLVDRADGILTITINRPQARNAINPAVARGIAAAVDELDASDELRIGILT
GAGGSFCAGMDLKGFLRGELPSIEGRGFGGLTARPPRKPLIAAVEGYALAGGFELVLACD
LVVAADNAQFGVPEVKRGLAATAGGLVRLPRQLPYRIALELALTGDMFPARRAHGYGLIN
QLTEPGQALDAARELARRIVANGPLAVAASKRVVVESQDWPADEVWERQAALTEHVFESA
DAREGSAAFAEKRQPVWQGK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcaagcccccgatgccgcggaagtcctcgtcgaccgtgccgacggcattctc
accatcaccatcaaccggccgcaggcccgcaacgcgatcaacccggcggtggcgcgcggc
atcgccgcggcggtcgacgagctcgacgccagcgacgagctgcgcatcggcatcctgacc
ggcgccggcggttcgttctgcgccggcatggatctcaagggcttcctgcgcggcgagctg
cccagcatcgaggggcgcggcttcggcgggctgaccgcccggccgccgcgcaagccgctg
atcgcggcggtggagggctatgcgctggccggcggcttcgaactggtgctggcctgcgac
ctggtggtggcggccgacaatgcgcagttcggcgtgcccgaggtcaagcgcgggctggcg
gccacggccggcggcctggtgcgcctgccgcgccagctgccctaccgcatcgcgctggag
ctggcgctgaccggcgacatgttcccggcccggcgcgcccacggctatggcctgatcaac
cagctgaccgaacccggccaggcgctggacgcggcgcgcgaactggcgcggcgcatcgtc
gccaacgggccgctggccgtggccgccagcaagcgcgtggtggtcgagtcgcaggactgg
ccggccgacgaggtgtgggagcgccaggcggcgctgaccgagcatgtgttcgagtcggcc
gacgcgcgcgagggctcggcggccttcgcggaaaagcgccagcccgtctggcaggggaag
tag

DBGET integrated database retrieval system