KEGG   Bordetella bronchiseptica RB50: BB0835Help
Entry
BB0835            CDS       T00141                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BB0835
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BB0835
Enzymes [BR:bbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BB0835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
879761..880705
Genome map
AA seq 314 aa AA seqDB search
MIAASFPHGVSLIGAPTDIGAGQRGASMGPEALRVAGLVRLLERRGLQVTDRGNLQGAPN
PWRPPANGYRHLNEVIGWNQLVHDAVSAELRQERLPILLGGDHSLAIGSISAVARHCRAS
GRKLRVLWLDAHADFNTNRLTPTGNVHGMPVACLCGNGPAALTGMAGRTPAIEPGWVRQI
GIRSVDEGERNLVYDAGLEVYDMRYLDEVGMRAVMEAALAGLDPQTHLHVSFDVDFLDPE
LAPGVGTTVPGGPTYREAQLCMEMIADTGLMRSLDIVELNPALDVRNKTAQVAVDLVESL
FGKSTLMRRRPGSA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgctgcatcgttcccccacggggtcagcctgatcggcgcgcccaccgacatcggc
gcgggccagcgcggcgcttccatggggcccgaggccctgcgcgtggcgggcctggtgcgc
ctgctcgagcggcgcggcctgcaagtgaccgatcgcggcaacctgcagggcgcgcccaac
ccgtggcgcccgccggccaacggctaccggcacctcaacgaagtcatcggctggaaccag
ctcgtgcacgacgccgtcagcgccgagttgcgccaggagcgcctgcccatcctgctgggc
ggcgaccacagcctggccatcggctcgatcagcgcggtggcgcgccattgccgcgcgagc
ggccgcaagctgcgcgtgctgtggctggacgcgcacgccgacttcaataccaaccggctc
acgcccaccggcaacgtgcacggcatgccggtcgcctgcctgtgcggcaacggccccgcg
gcactgaccggcatggccggccgcacgccggccatcgaaccgggctgggtgcgccagatc
ggcatccgcagcgtggacgaaggcgaacgcaacctggtctacgacgccgggctggaggtc
tacgacatgcgctatctcgacgaggtcggcatgcgcgcggtgatggaggccgccctggcc
gggctggacccgcagacgcatttgcacgtcagcttcgacgtcgacttcctcgaccccgag
ctggcgccgggcgtgggcacgaccgtgcccggcggtcccacctatcgcgaagcccagctg
tgcatggaaatgatcgccgacaccggcctgatgcgctcgctggacatcgtcgaactcaat
cccgcgctggacgtgcgcaacaagaccgcccaggtcgcggtggacctggtcgaaagcctg
ttcggcaaatccaccctgatgcgccggcgccccggcagcgcctga

DBGET integrated database retrieval system