KEGG   Bordetella bronchiseptica RB50: BB0835Help
Entry
BB0835            CDS       T00141                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00220  Arginine biosynthesis
bbr00330  Arginine and proline metabolism
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01130  Biosynthesis of antibiotics
bbr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbr00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BB0835
   00330 Arginine and proline metabolism
    BB0835
Enzymes [BR:bbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BB0835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: CAE31334
GeneDB: BB0835
UniProt: A0A0H3LI48
Position
879761..880705
Genome map
AA seq 314 aa AA seqDB search
MIAASFPHGVSLIGAPTDIGAGQRGASMGPEALRVAGLVRLLERRGLQVTDRGNLQGAPN
PWRPPANGYRHLNEVIGWNQLVHDAVSAELRQERLPILLGGDHSLAIGSISAVARHCRAS
GRKLRVLWLDAHADFNTNRLTPTGNVHGMPVACLCGNGPAALTGMAGRTPAIEPGWVRQI
GIRSVDEGERNLVYDAGLEVYDMRYLDEVGMRAVMEAALAGLDPQTHLHVSFDVDFLDPE
LAPGVGTTVPGGPTYREAQLCMEMIADTGLMRSLDIVELNPALDVRNKTAQVAVDLVESL
FGKSTLMRRRPGSA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgctgcatcgttcccccacggggtcagcctgatcggcgcgcccaccgacatcggc
gcgggccagcgcggcgcttccatggggcccgaggccctgcgcgtggcgggcctggtgcgc
ctgctcgagcggcgcggcctgcaagtgaccgatcgcggcaacctgcagggcgcgcccaac
ccgtggcgcccgccggccaacggctaccggcacctcaacgaagtcatcggctggaaccag
ctcgtgcacgacgccgtcagcgccgagttgcgccaggagcgcctgcccatcctgctgggc
ggcgaccacagcctggccatcggctcgatcagcgcggtggcgcgccattgccgcgcgagc
ggccgcaagctgcgcgtgctgtggctggacgcgcacgccgacttcaataccaaccggctc
acgcccaccggcaacgtgcacggcatgccggtcgcctgcctgtgcggcaacggccccgcg
gcactgaccggcatggccggccgcacgccggccatcgaaccgggctgggtgcgccagatc
ggcatccgcagcgtggacgaaggcgaacgcaacctggtctacgacgccgggctggaggtc
tacgacatgcgctatctcgacgaggtcggcatgcgcgcggtgatggaggccgccctggcc
gggctggacccgcagacgcatttgcacgtcagcttcgacgtcgacttcctcgaccccgag
ctggcgccgggcgtgggcacgaccgtgcccggcggtcccacctatcgcgaagcccagctg
tgcatggaaatgatcgccgacaccggcctgatgcgctcgctggacatcgtcgaactcaat
cccgcgctggacgtgcgcaacaagaccgcccaggtcgcggtggacctggtcgaaagcctg
ttcggcaaatccaccctgatgcgccggcgccccggcagcgcctga

DBGET integrated database retrieval system